Recombinant Human Motilin receptor(MLNR)

Code CSB-CF014639HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O43193
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MGSPWNGSDGPEGAREPPWPALPPCDERRCSPFPLGALVPVTAVCLCLFVVGVSGNVVTV MLIGRYRDMRTTTNLYLGSMAVSDLLILLGLPFDLYRLWRSRPWVFGPLLCRLSLYVGEG CTYATLLHMTALSVERYLAICRPLRARVLVTRRRVRALIAVLWAVALLSAGPFLFLVGVE QDPGISVVPGLNGTARIASSPLASSPPLWLSRAPPPSPPSGPETAEAAALFSRECRPSPA QLGALRVMLWVTTAYFFLPFLCLSILYGLIGRELWSSRRPLRGPAASGRERGHRQTVRVL LVVVLAFIICWLPFHVGRIIYINTEDSRMMYFSQYFNIVALQLFYLSASINPILYNLISK KYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGDTVGYTETSANVKTMG
Source in vitro E.coli expression system
Gene Names MLNR
Protein Names Recommended name: Motilin receptor Alternative name(s): G-protein coupled receptor 38
Expression Region 1-412
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for motilin.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed only in thyroid, stomach, and bone marrow.
Database Links

HGNC: 4495

OMIM: 602885

KEGG: hsa:2862

STRING: 9606.ENSP00000218721

UniGene: Hs.248126

Related Products

MLNR Antibodies

MLNR Antibodies for Homo sapiens (Human)

MLNR Proteins

MLNR Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.