Recombinant Human NADPH oxidase 5(NOX5)

Code CSB-CF822280HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96PH1
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MNTSGDPAQTGPEGCRGTMSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESF FAERFFALFDSDRSGTITLQELQEALTLLIHGSPMDKLKFLFQVYDIDVCARQGASAGTE WGAGAGPHWASSPLGTGSGSIDPDELRTVLQSCLRESAISLPDEKLDQLTLALFESADAD GNGAITFEELRDELQRFPGVMENLTISAAHWLTAPAPRPRPRRPRQLTRAYWHNHRSQLF CLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCLNFDCSFIAVLMLRRCLTWLRATW LAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASPFQFWELLLTTRPGI GWVHGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYLLVWLLLIFHGPNFW KWLLVPGILFFLEKAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRPPFFHYRPGDYLYLN IPTIARYEWHPFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKASDPLGRGSKRLSRSVT MRKSQRSSKGSEILLEKHKFCNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFASIL QSIMYRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQ AEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDW SKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF
Source in vitro E.coli expression system
Gene Names NOX5
Protein Names Recommended name: NADPH oxidase 5 EC= 1.6.3.-
Expression Region 1-765
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Calcium-dependent NADPH oxidase that generates superoxide. Also functions as a calcium-dependent proton channel and may regulate redox-dependent processes in lymphocytes and spermatozoa. May play a role in cell growth and apoptosis. Isoform v2 and isoform v5 are involved in endothelial generation of reactive oxygen species (ROS), proliferation and angiogenesis and contribute to endothelial response to thrombin.
Subcellular Location Membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Isoform v2: Endoplasmic reticulum, SUBCELLULAR LOCATION: Isoform v5: Endoplasmic reticulum
Tissue Specificity Mainly expressed in pachytene spermatocytes of testis and in lymphocyte-rich areas of spleen and lymph nodes. Isoform v1 is expressed in spleen. Isoform v2 is expressed in testis. Also detected in ovary, placenta, pancreas, cardiac fibroblasts. Expressed
Database Links

HGNC: 14874

OMIM: 606572

KEGG: hsa:79400

STRING: 9606.ENSP00000373518

UniGene: Hs.657932

Related Products

NOX5 Antibodies

NOX5 Antibodies for Homo sapiens (Human)

NOX5 Antibodies for Human

NOX5 Proteins

NOX5 Proteins for Homo sapiens (Human)

NOX5 ELISA Kit

NOX5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.