Recombinant Human NEDD4 family-interacting protein 2(NDFIP2)

Code CSB-CF885735HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9NV92
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGG GRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAI EQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVA TSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMA FIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL VLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL
Source in vitro E.coli expression system
Gene Names NDFIP2
Protein Names Recommended name: NEDD4 family-interacting protein 2 Alternative name(s): NEDD4 WW domain-binding protein 5A Putative MAPK-activating protein PM04/PM05/PM06/PM07 Putative NF-kappa-B-activating protein 413
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, may control many cellular processes. Recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. Negatively regulates KCNH2 potassium channel activity by decreasing its cell-surface expression and interfering with channel maturation through recruitment of NEDD4L to the Golgi apparatus and multivesicular body where it mediates KCNH2 degradation
Subcellular Location Endosome membrane, Multi-pass membrane protein, Golgi apparatus membrane, Endosome, multivesicular body membrane
Tissue Specificity Expressed in brain, lung, heart, skeletal muscle, kidney, liver and placenta.
Database Links

HGNC: 18537

OMIM: 610041

KEGG: hsa:54602

STRING: 9606.ENSP00000218652

UniGene: Hs.525093

Related Products

NDFIP2 Proteins

NDFIP2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.