Recombinant Human Olfactory receptor 2T1(OR2T1)

Code CSB-CF527358HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O43869
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MWQEYYFLNVFFPLLKVCCLTINSHVVILLPWECYHLIWKILPYIGTTVGSMEEYNTSST DFTFMGLFNRKETSGLIFAIISIIFFTALMANGVMIFLIQTDLRLHTPMYFLLSHLSLID MMYISTIVPKMLVNYLLDQRTISFVGCTAQHFLYLTLVGAEFFLLGLMAYDRYVAICNPL RYPVLMSRRVCWMIIAGSWFGGSLDGFLLTPITMSFPFCNSREINHFFCEAPAVLKLACA DTALYETVMYVCCVLMLLIPFSVVLASYARILTTVQCMSSVEGRKKAFATCSSHMTVVSL FYGAAMYTYMLPHSYHKPAQDKVLSVFYTILTPMLNPLIYSLRNKDVTGALKRALGRFKG PQRVSGGVF
Source in vitro E.coli expression system
Gene Names OR2T1
Protein Names Recommended name: Olfactory receptor 2T1 Alternative name(s): Olfactory receptor 1-25 Short name= OR1-25 Olfactory receptor OR1-61
Expression Region 1-369
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 8277

KEGG: hsa:26696

STRING: 9606.ENSP00000355430

UniGene: Hs.626885

Related Products

OR2T1 Antibodies

OR2T1 Antibodies for Homo sapiens (Human)

OR2T1 Proteins

OR2T1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.