Recombinant Human Peroxisomal membrane protein 11B(PEX11B)

Code CSB-CF017796HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O96011
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG GGLPQLALKLRLQVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGL VSSILSILTLIYPWLRLKP
Source in vitro E.coli expression system
Gene Names PEX11B
Protein Names Recommended name: Peroxisomal membrane protein 11B Alternative name(s): Peroxin-11B Peroxisomal biogenesis factor 11B Protein PEX11 homolog beta Short name= PEX11-beta
Expression Region 1-259
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in peroxisomal proliferation
Involvement in disease Peroxisome biogenesis disorder 14B (PBD14B)
Subcellular Location Peroxisome membrane, Single-pass membrane protein
Protein Families Peroxin-11 family
Database Links

HGNC: 8853

OMIM: 603867

KEGG: hsa:8799

STRING: 9606.ENSP00000358312

UniGene: Hs.714608

Related Products

PEX11B Antibodies

PEX11B Antibodies for Homo sapiens (Human)

PEX11B Antibodies for Human

PEX11B Proteins

PEX11B Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.