Recombinant Human Phospholemman (FXYD1)

Code CSB-CF009089HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
FXYD1; PLM; Phospholemman; FXYD domain-containing ion transport regulator 1; Sodium/potassium-transporting ATPase subunit FXYD1
Species
Homo sapiens (Human)
Expression Region
21-92
Target Protein Sequence
ESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na(+) out of the cell and K(+) into the cell. Inhibits NKA activity in its unphosphorylated state and stimulates activity when phosphorylated. Reduces glutathionylation of the NKA beta-1 subunit ATP1B1, thus reversing glutathionylation-mediated inhibition of ATP1B1. Contributes to female sexual development by maintaining the excitability of neurons which secrete gonadotropin-releasing hormone.
Gene References into Functions
  1. Study demonstrated that the expression of FXYD1, FXYD3 and FXYD5 is elevated in the lungs of Acute respiratory distress syndrome patients PMID: 26410457
  2. a period of high-intensity training with reduced training volume increases expression and phosphorylation levels of FXYD1, which may affect Na(+)/K(+) pump activity and muscle K(+) homeostasis during intense exercise. PMID: 26791827
  3. Stopped-flow experiments using the dye RH421 show that FXYD1 slows the conformational transition E2(2K)ATP --> E1(3Na)ATP but does not affect 3NaE1P --> E2P3Na. PMID: 26429909
  4. the evolutionary conservation of G-quadruplex forming sequences with the confirmation of G-quadruplex formation in vitro by two FXYD1 homologues PMID: 25051342
  5. Phospholemman is the target of a variety of post-translational modifications and these can dynamically alter the activity of the Na pump. [Review] PMID: 23672825
  6. PLM regulates important ion transporters in the heart and offers a tempting target for development of drugs to treat heart failure. PMID: 23224879
  7. Intracellular trafficking of FXYD1 (phospholemman) and FXYD7 proteins in Xenopus oocytes and mammalian cells. PMID: 22535957
  8. the severity of the spinal cord lesion is an important factor controlling the expression of Na(+)-K(+)-ATPase and its regulatory protein PLM PMID: 22275761
  9. in left ventricular myocardium from patients with heart failure, PLM Ser-68 phosphorylation was approximately 50% lower than in nonfailing controls PMID: 21849407
  10. Exercise induces FXYD1 phosphorylation at multiple sites in human muscle; in mice, contraction-induced changes in FXYD1 phosphorylation are fiber-type specific and dependent on protein kinase Calpha activity. PMID: 21957166
  11. FXYD1 raises the affinity of the human alpha1beta1 isoform of Na,K-ATPase for Na ions PMID: 21449573
  12. Results suggest that the PLM cytoplasmic domain populates NKA-associated and membrane-associated states in dynamic equilibrium and that phosphorylation may alter the position of the equilibrium. PMID: 21130070
  13. phosphorylation of PLM increases its oligomerization into tetramers, decreases its binding to NKA, and alters the structures of both the tetramer and NKA regulatory complex. PMID: 21220422
  14. PLM phosphorylation at either Ser63 or Ser68 is both necessary and sufficient for completely relieving the PLM-induced NKA inhibition. PMID: 20861470
  15. Data suggest that phospholemman plays an important role in fine tuning the gating kinetics of cardiac calcium channels and likely plays an important role in shaping the cardiac action potential and regulating Ca(2+) dynamics in the heart. PMID: 20720179
  16. Phospholemman modulates the gating of cardiac L-type calcium channels PMID: 20371314
  17. Study reveals, in various human tissues, the specific expression of FXYD1, which may associate with Na, K-ATPase in selected cell types and modulate its catalytic properties. PMID: 19879113
  18. molecular cloning, protein expression, sequencing and NMR structure determination PMID: 12535606
  19. show that the helical regions and connecting segments of FXYD1, FXYD3, and FXYD4 determined in micelles by NMR spectroscopy coincide with the positions of intron-exon junctions in the genes PMID: 16288923
  20. PLM interacts with the intracellular loop of NCX1, most likely at residues 218-358 PMID: 16921169
  21. study reports that FXYD1 is elevated in frontal cortex neurons of Rett syndrome patients and Mecp2-null mice; FXYD1 is identified as a MeCP2 target gene whose de-repression may directly contribute to RTT neuronal pathogenesis PMID: 17309881
  22. the structure of FXYD1 suggests a mechanism whereby the phosphorylation of conserved Ser residues, by protein kinases A and C, could induce a conformational change in the cytoplasmic domain, to modulate its interaction with the Na,K-ATPase, alpha subunit PMID: 18000745
  23. reconstituted FXYD1 protects both alpha1beta1 and alpha2beta1 very strongly against thermal inactivation PMID: 18052210
  24. Data show that PLM associates with and modulates both NKA-alpha1 and NKA-alpha2 in a comparable but not identical manner. PMID: 19638348

Show More

Hide All

Subcellular Location
Cell membrane, sarcolemma; Single-pass type I membrane protein. Apical cell membrane; Single-pass type I membrane protein. Membrane, caveola. Cell membrane, sarcolemma, T-tubule.
Protein Families
FXYD family
Tissue Specificity
Highest expression in skeletal muscle and heart. Moderate levels in brain, placenta, lung, liver, pancreas, uterus, bladder, prostate, small intestine and colon with mucosal lining. Very low levels in kidney, colon and small intestine without mucosa, pros
Database Links

HGNC: 4025

OMIM: 602359

KEGG: hsa:5348

STRING: 9606.ENSP00000343314

UniGene: Hs.442498

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1