Recombinant Human Potassium channel subfamily K member 9 (KCNK9)-VLPs

Code CSB-MP889068HU
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
KCNK9
Uniprot No.
Research Area
Neuroscience
Alternative Names
(Acid-sensitive potassium channel protein TASK-3)(TWIK-related acid-sensitive K(+) channel 3)(Two pore potassium channel KT3.2)(Two pore K(+) channel KT3.2)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-374aa
Target Protein Sequence
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
pH-dependent, voltage-insensitive, background potassium channel protein.
Gene References into Functions
  1. observations implicate TASK-3 as a critical factor in cell cycle progression and corroborate its potential as a therapeutic target in breast cancer treatment. PMID: 29596383
  2. point mutations in DLK1 and KCNK9 at least do not seem to be a common cause of central precocious puberty in girls. PMID: 28672280
  3. In conclusion, we have identified the first selective activator of the two-pore domain potassium channel TASK3. PMID: 28882594
  4. KCNK9 imprinting syndrome is a rare cause of intellectual disability, congenital hypotonia, palatal abnormalities, and occasional seizures. PMID: 27151206
  5. Our results provide evidence for new loci influencing abdominal visceral (BBS9, ADCY8, KCNK9) and subcutaneous (MLLT10/DNAJC1/EBLN1) fat, and confirmed a locus (THNSL2) previously reported to be associated with abdominal fat in women. PMID: 26480920
  6. TASK-1 and TASK-3 may form heterodimers in human atrial cardiomyocytes. PMID: 25655935
  7. During conductance simulation experiments, both TASK-3 and TREK-1 channels were able to repolarise the membrane once AP threshold was reached PMID: 25482670
  8. The findings of this study suggest that variations in KCNK9 genes are associated with both mild and severe persistent breast pain after breast cancer surgery. PMID: 25599232
  9. Diacylglycerol mediates regulation of TASK1 and TASK3 potassium channels by GNAQ. PMID: 25420509
  10. Interference with TASK-3 channel expression, therefore, induces caspase-dependent and -independent apoptosis of melanoma cells, most likely via causing mitochondrial depolarization. PMID: 25318378
  11. K2P3.1 and K2P9.1 undergo rapid dynamin-dependent endocytosis PMID: 23807092
  12. Mutations of KCNK9 or epigenetic disturbances within the PEG13 imprinted cluster do not significantly contribute to the cause of the developmental disabilities tested in this study. PMID: 24980697
  13. Two SNPs replicated: the paternal rs2471083-C allele (located near the imprinted KCNK9 gene) and the paternal rs3091869-T allele (located near the SLC2A10 gene) increased BMI equally (beta = 0.11 (SD), P<0.0027) PMID: 25078964
  14. For KCNK9, two SNPs (i.e., rs3780039, rs11166921) were associated with the occurrence of preoperative breast pain. PMID: 24392765
  15. We observed co-localization of the TASK-3 protein and a mitochondrial marker in the mitochondria of HaCaT cells. PMID: 24126847
  16. By both a gain-of-function additional mutation of TASK3 channels. PMID: 24342771
  17. TNFalpha activation and TASK3 channel activity can promote cellular apoptosis. PMID: 24307172
  18. Overexpression of TASK-3 expression is associated with ovarian cancer. PMID: 23564779
  19. Results of an exploratory study suggest that blood pressure and aldosterone production may be affected by variations in KCNK9. The findings could have relevance to risk for hypertension. PMID: 22893713
  20. an increase in TASK-3 expression levels reduces cell migration/invasion in breast cancer cells PMID: 21910834
  21. Depletion of the endogenous phosphatidylinositol-4,5-bisphosphate pool in living cells consistently finds no change in currents mediated by TASK-1 and TASK-3. PMID: 21540350
  22. TASK-3 immunoreactivity was detected in both astrocytes and microglia of temporal lobe epilepsy patients. PMID: 21710317
  23. TASK-3 channels are functionally present in the mitochondria of the melanoma cells, and their function is essential for the survival of these cells. PMID: 21512417
  24. cAMP-dependent protein kinase is responsible for the phosphorylation of the terminal serine in both K(2P)3.1 and K(2P)9.1 PMID: 21357689
  25. Western analysis confirms expression of TASK1 and TASK3 in medulloblastoma cells. PMID: 20931182
  26. KCNK9 gene is imprinted in human and mouse, exhibiting preferential expression from the maternal allele in brain. PMID: 17704508
  27. TASK-1 and 3 are determinant of aldosterone secretion and adrenocortical zonation. PMID: 20049674
  28. TASK-3 responds to voltage in a way that reveals gating at its inner, cytoplasmic mouth through movements of membrane helices M2 and M4. PMID: 19703964
  29. TASK-1 and TASK-3 differed insofar as a large portion of the C terminus was necessary for the full effects of halothane and TRH on TASK-3 but not on TASK-1 PMID: 11886861
  30. Overexpression of KCNK9 in cell lines promotes tumor formation and confers resistance to both hypoxia and serum deprivation. PMID: 12676587
  31. results establish a direct link between the potassium channel activity of TASK3 and its oncogenic functions and imply that blockers for this potassium channel may have therapeutic potential for the treatment of cancers PMID: 12782791
  32. TASK3 is expressed in pia mater, astrocytes, Purkinje and granule cells PMID: 15197476
  33. TASK-3 channels underlie a major component of cerebellar granule neurons leak current which is sensitive to block by zinc PMID: 15284350
  34. Overexpression rather than mutation of the KCNK9 gene may contribute to the development of colorectal cancers. PMID: 15601307
  35. The expression pattern of TASK-3 in Melanoma cells is determined. PMID: 17013562
  36. (Glutamic acid-aspartic acid-glutamic acid) in human TASK-3 is a major determinant of the rate of endoplasmic reticulum export and is required for efficient surface expression of the channel. PMID: 17547699
  37. TASK-3 channels are present in the mitochondria in both malignantly transformed and healthy cells, suggesting that they might have roles in ensuring mitochondrial functions. PMID: 18094996
  38. TASK3 channels may possibly represent a novel molecular target for the treatment of human glioblastoma PMID: 18217213
  39. K(2)P channels as novel potassium conductance on T lymphocytes critically influencing T cell effector function and identify a possible molecular target for immunomodulation in T cell-mediated autoimmune disorders PMID: 18375952
  40. the TASK3 M1P1 loop lies close to the pore, regulating TASK3 channel activity PMID: 18417474
  41. a mutation in the genomically imprinted potassium channel KCNK9 may have a role in the maternally inherited Birk Barel mental retardation dysmorphism syndrome PMID: 18678320
  42. Thus, regulated expression of TASK channels might contribute to a molecular switch between death and survival of neurons in autoimmune CNS inflammation. PMID: 18824070
  43. Both TASK-3 and TREK-1 are functionally operational in the adrenocortical H295R cell line, modulate membrane potential and aldosterone secretion. PMID: 18854423

Show More

Hide All

Involvement in disease
Birk-Barel mental retardation dysmorphism syndrome (BIBAS)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity
Mainly found in the cerebellum. Also found in adrenal gland, kidney and lung.
Database Links

HGNC: 6283

OMIM: 605874

KEGG: hsa:51305

STRING: 9606.ENSP00000302166

UniGene: Hs.493037

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*