Recombinant Human Potassium channel subfamily K member 9(KCNK9)

Code CSB-CF889068HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9NPC2
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYR QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQ CEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCT CYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHS FTDHQRLMKRRKSV
Source in vitro E.coli expression system
Gene Names KCNK9
Protein Names Recommended name: Potassium channel subfamily K member 9 Alternative name(s): Acid-sensitive potassium channel protein TASK-3 TWIK-related acid-sensitive K(+) channel 3 Two pore potassium channel KT3.2 Short name= Two pore K(+) chan
Expression Region 1-374
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function pH-dependent, voltage-insensitive, background potassium channel protein.
Involvement in disease Birk-Barel mental retardation dysmorphism syndrome (BIBAS)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Mainly found in the cerebellum. Also found in adrenal gland, kidney and lung.
Database Links

HGNC: 6283

OMIM: 605874

KEGG: hsa:51305

STRING: 9606.ENSP00000302166

UniGene: Hs.493037

Related Products

KCNK9 Antibodies

KCNK9 Antibodies for Homo sapiens (Human)

KCNK9 Antibodies for Human

KCNK9 Proteins

KCNK9 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.