Recombinant Human Presenilins-associated rhomboid-like protein, mitochondrial(PARL)

Code CSB-CF880960HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9H300
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence FRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCA FGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGI IAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSF SSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIP EGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHEL IWKNREPLVKIWHEIRTNGPKKGGGSK
Source in vitro E.coli expression system
Gene Names PARL
Protein Names Recommended name: Presenilins-associated rhomboid-like protein, mitochondrial EC= 3.4.21.105 Alternative name(s): Mitochondrial intramembrane cleaving protease PARL Cleaved into the following chain: 1. P-beta Short name= 2. Pbeta
Expression Region 53-379
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the control of apoptosis during postnatal growth. Essential for proteolytic processing of an antiapoptotic form of OPA1 which prevents the release of mitochondrial cytochrome c in response to intrinsic apoptoptic signals (By similarity). Promotes changes in mitochondria morphology regulated by phosphorylation of P-beta domain.
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: P-beta: Nucleus
Protein Families Peptidase S54 family
Database Links

HGNC: 18253

OMIM: 607858

KEGG: hsa:55486

STRING: 9606.ENSP00000325421

UniGene: Hs.478469

Related Products

PARL Antibodies

PARL Antibodies for Human

PARL Proteins

PARL Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.