Recombinant Human Prolactin-releasing peptide receptor(PRLHR)

Code CSB-CF018726HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P49683
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK GLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAY AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAV LAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLV ILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLL RDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPH GQNMTVSVVI
Source in vitro E.coli expression system
Gene Names PRLHR
Protein Names Recommended name: Prolactin-releasing peptide receptor Short name= PrRP receptor Short name= PrRPR Alternative name(s): G-protein coupled receptor 10 hGR3
Expression Region 1-370
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Only detected in the pituitary gland and in all cell types of pituitary adenomas.
Database Links

HGNC: 4464

OMIM: 600895

KEGG: hsa:2834

STRING: 9606.ENSP00000239032

UniGene: Hs.248119

Related Products

PRLHR Antibodies

PRLHR Antibodies for Homo sapiens (Human)

PRLHR Proteins

PRLHR Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.