Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF018726HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P49683 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Sequence | MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK GLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAY AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAV LAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLV ILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLL RDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPH GQNMTVSVVI |
| Source | in vitro E.coli expression system |
| Gene Names | PRLHR |
| Protein Names | Recommended name: Prolactin-releasing peptide receptor Short name= PrRP receptor Short name= PrRPR Alternative name(s): G-protein coupled receptor 10 hGR3 |
| Expression Region | 1-370 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | Full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family |
| Tissue Specificity | Only detected in the pituitary gland and in all cell types of pituitary adenomas. |
| Database Links |
HGNC: 4464 OMIM: 600895 KEGG: hsa:2834 STRING: 9606.ENSP00000239032 UniGene: Hs.248119 |
PRLHR Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA008903 | PRLHR Antibody | Human,Mouse,Rat | WB,IF,ELISA |
PRLHR Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP018726HU1 CSB-EP018726HU1 CSB-BP018726HU1 CSB-MP018726HU1 |
Recombinant Human Prolactin-releasing peptide receptor(PRLHR),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Granulocyte-macrophage colony-stimulating factor(CSF2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Neurofilament heavy polypeptide(NEFH),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Cat Serum amyloid A protein(SAA1),partial
Express system: E.coli
Species: Felis catus (Cat) (Felis silvestris catus)
Recombinant Human DNA-(apurinic or apyrimidinic site) lyase(APEX1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human L-dopachrome tautomerase (DCT),Partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Clathrin heavy chain 2(CLTCL1) ,partial
Express system: E.coli
Species: Homo sapiens (Human)
