Recombinant Human Prostaglandin E2 receptor EP3 subtype (PTGER3)

Code CSB-CF018972HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
PTGER3; Prostaglandin E2 receptor EP3 subtype; PGE receptor EP3 subtype; PGE2 receptor EP3 subtype; PGE2-R; Prostanoid EP3 receptor
Species
Homo sapiens (Human)
Expression Region
1-390
Target Protein Sequence
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI RYHTNNYASSSTSLPCQCSSTLMWSDHLER
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. Required for normal development of fever in response to pyrinogens, including IL1B, prostaglandin E2 and bacterial lipopolysaccharide (LPS). Required for normal potentiation of platelet aggregation by prostaglandin E2, and thus plays a role in the regulation of blood coagulation. Required for increased HCO3(-) secretion in the duodenum in response to mucosal acidification, and thereby contributes to the protection of the mucosa against acid-induced ulceration. Not required for normal kidney function, normal urine volume and osmolality.
Gene References into Functions
  1. In sporadic breast cancer, EP3 receptor expression is not significantly associated with clinicopathological parameters but is a significant prognostic factor for improved progression-free and overall survival. However, the functional aspects of EP3 receptor in breast cancer and the way how EP3 may oppose the pro-tumorigenic effects of PGE2 elevation and COX-2 overexpression are not fully understood so far. PMID: 29661238
  2. Study reports that EP3 expression is elevated in TSC2- deficient patient-derived cells compared with TSC2-addback cells, and that EP3 antagonist selectively suppresses the proliferation of TSC2-deficient cells. The elevated expression of EP3 is mediated by Rheb in an mTORC1-independent fashion. PMID: 28710231
  3. Study showed the EP3 expression is correlated to the FIGO classification and, demonstrates that an increased EP3 expression correlates with a negative outcome of overall survival of cervical carcinoma patients. In addition, different expression of EP3 was found in correlation to the histological subtype. Patients with adenocarcinoma and high expression of EP3 had a worse outcome survival. PMID: 28753926
  4. Its signaling pathway impairs hippocampal presynaptic long-term plasticity in Alzheimer's disease. PMID: 27837675
  5. findings show that prostaglandin E2 EP3 receptor contributes to thrombin-induced brain damage via Rho-Rho kinase-mediated cytotoxicity and proinflammatory responses. PMID: 26661165
  6. S211L within EP3 is the key residue to distinguish PGE1 and PGE2 binding to mediate diverse biological functions at the initial recognition step PMID: 28065721
  7. The present study identified the functions of EP3 and the mechanisms by which PGE2 regulates beta-catenin expression and promoted cholangiocarcinoma cell growth and invasion PMID: 26058972
  8. results demonstrate that risk of unsuccessful periodontal treatment is associated with tag SNPs in specific genes that regulate the inflammatory response, one of which is also associated with sPTB. PMID: 23805813
  9. Failure of cervical ripening, after local application of prostaglandins for labor induction, may be caused by the increased expression of EP3 and concomitant decrease in EP4 expression. PMID: 24180609
  10. Human prostate cancer is associated with EP4 and EP2 overexpression and reduced EP3 expression. PMID: 23364535
  11. EP3 downregulation contributed to prostate carcinogenesis and to progression from androgen-dependent prostate cancer to castration-resistant prostate cancer by regulating androgen receptor expression. PMID: 23493387
  12. Neuronal prostaglandin E2 receptor subtype EP3 mediates antinociception during inflammation. PMID: 23904482
  13. Prostaglandin E2 receptor, EP3, is induced in diabetic islets and negatively regulates glucose- and hormone-stimulated insulin secretion. PMID: 23349487
  14. EP(3) receptors located postsynaptically strongly contract human pulmonary arteries. PMID: 23406763
  15. This study identify the PGE(2) EP3 receptor as a novel proinflammatory, proamyloidogenic, and synaptotoxic signaling pathway, and suggest a role for COX-PGE(2) -EP3 signaling in the development of AD. PMID: 22915243
  16. laropiprant by itself attenuated platelet activation induced by thromboxane (TP) and E-type prostanoid (EP)-3 receptor stimulation, as demonstrated in assays of platelet aggregation PMID: 22870195
  17. epistatic interaction with prostaglandin E receptor 3 gene confers an increased risk for Stevens-Johnson syndrome with severe ocular surface complications PMID: 22421267
  18. Prostaglandin E2 induced contraction of human intercostal arteries is mediated by the EP3 receptor PMID: 22342278
  19. The levels of prostaglandin-endoperoxide synthase 1 (PTGS1; aka COX-1) and prostaglandin-endoperoxide receptor 3 (PTGER3) mRNA are increased in patient with schizophrenia. PMID: 22397921
  20. EP3 is the primary receptor subtype that mediates PGE(2) induced contractility in human pregnant myometrium at term and represents a possible therapeutic target. PMID: 22162473
  21. Data posit an association between the down-regulation of EP3 in conjunctival epithelium and the pathogenesis and pathology of SJS/TEN and OCP, and suggest a common mechanism(s) in the pathology of these diseases. PMID: 21966456
  22. A positive feedback pathway involving COX-2/PGE2/EP3 receptor-dependent EGFR reactivation exaggerates IL-8 production in NCI-H292 cancer cells but not in NHBE (normal) cells. PMID: 21925169
  23. The role of PGE(2) in human atherosclerotic plaque on platelet EP(3) and EP(4) receptor activation and platelet function in whole blood. PMID: 21424266
  24. lower levels in the conjunctival epithelial cells of Stevens-Johnson syndrome patients PMID: 20947153
  25. downregulated in endometriosis tissues PMID: 20452033
  26. Studies indicate assocation of PTGER3 and PON1 genotypes with preterm birth. PMID: 20140262
  27. EP3 regulates VM and the associated increased MMP-2 enzyme activity. PMID: 20503412
  28. The present results address the novel activities of COX-2/PGE2-EP3/EP4 signaling that modulate tumor biology and show that CXCL12/CXCR4 axis may play a crucial role in tumor stromal formation and angiogenesis under the control of prostaglandins. PMID: 20110411
  29. EP3 receptor signaling on endothelial cells is essential for the MMP-9 upregulation that enhances tumor metastasis and angiogenesis. PMID: 19799610
  30. expression of prostaglandin E receptor 3-2 was significantly lower in gravid than nongravid myometrium while levels of the prostaglandin E receptor 3-6 message were higher in gravid samples than in nongravid specimens PMID: 12699873
  31. An agonist of EP(3), an inhibitory pathway, antagonized activity levels induced by PGE(2). Generally reflective of changes in aromatase protein expression and the pattern of mRNA expression. PMID: 12788892
  32. EP3 and EP4 mediate different actions of PGE2 on mature human osteoclasts. Activation of EP4 receptors inhibits actin ring formation and activation of EP3 receptors increases number of lamellipodia. PMID: 15290741
  33. When expressed in HEK293 cells, the isoforms located to the cell surface, although a fraction of some remained in the cell. PMID: 15304361
  34. Prostaglandin (PG)E2 augments intracellular calcium levels in the T-leukemic cell line Jurkat through the E-prostanoid (EP)3 receptor. PMID: 15528329
  35. EP3 receptors produce epidermal growth inhibition through the action of Ddiacylglycerol and ceramide second messengers. PMID: 16274459
  36. analysis of a prostaglandin EP3alpha receptor intracellular loop peptide by NMR PMID: 16707103
  37. the association between EH and nucleotide polymorphisms in the gene encoding the prostaglandin E2 receptor subtype EP2 (PTGER2). PMID: 17644362
  38. Study indicates that genetic variations (single nucleotide polymorphism 1388T>C) in the Ptger3 gene are significantly associated with the risk and severity of asthma in the Korean population. PMID: 17877755
  39. We identified a new mRNA splice variant of the EP3 gene in human gastric fundic mucosa, mammary artery and pulmonary vessels. This EP3-Ic transcript contains exons 1, 2, 3, 5 and 6 of the EP3 gene and should be translated in the EP3-I isoform. PMID: 18023986
  40. results showed that EP3 is expressed in trigeminal neurons (53% of total neurons), and is co-expressed in TRPV(1)-positive neurons (67 % of TRPV(1)-positive neurons. PMID: 18296611
  41. Data suggest that expression of prostanoid receptors (prostaglandin E2 EP3-I, prostacyclin, and thromboxane A2 receptors) in vascular inflammation could influence cell responses dependent on the constitutive activation of ghrelin receptors. PMID: 18573679
  42. EP3 receptors are involved in bladder micturition at supraspinal and spinal centers and in bladder nociception at the spinal cord PMID: 18632791
  43. This study found that the non-conserved S211 and R214 of the hEP3 are involved in PGE(2) recognition. PMID: 18652829
  44. Stimulation of the EP3(I) isoform of the human EP3 receptor with prostaglandin E(2) increases the mRNA expression of both VEGF and its cognate receptor VEGF receptor-1. PMID: 18996083
  45. examined the contributions of EP3 to platelet function using the selective EP3 agonist sulprostone and also PGE(2) PMID: 19012178
  46. In human parturition, there is decreased mRNA expression of lower-uterine segment EP3 receptor isoforms II and VI during labour. PMID: 19165680

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in kidney. Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.
Database Links

HGNC: 9595

OMIM: 176806

KEGG: hsa:5733

STRING: 9606.ENSP00000349003

UniGene: Hs.445000

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1