Recombinant Human Protein FAM176A(FAM176A)

Code CSB-CF862042HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9H8M9
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MRLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLAALVIRISCH TDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLNKNVFTSAEELER AQRLEERERIIREIWMNGQPEVPGTRSLNRYY
Source in vitro E.coli expression system
Gene Names EVA1A
Protein Names Recommended name: Protein FAM176A Alternative name(s): Transmembrane protein 166
Expression Region 1-152
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein, Lysosome membrane, Single-pass membrane protein
Protein Families EVA1 family
Tissue Specificity Expressed in lung, kidney, liver, pancreas, placenta, but not in heart and skeletal muscle.
Database Links

HGNC: 25816

KEGG: hsa:84141

STRING: 9606.ENSP00000233712

UniGene: Hs.302346

Related Products

EVA1A Antibodies

EVA1A Antibodies for Homo sapiens (Human)

EVA1A Antibodies for Human

EVA1A Proteins

EVA1A Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.