Recombinant Human RING finger protein 170(RNF170)

Code CSB-CF019857HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96K19
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELV RVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSW LGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTL LRHAFREMFSVGGLFWMFRIRIILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLL LIYISIMYREVITQRLTR
Source in vitro E.coli expression system
Gene Names RNF170
Protein Names Recommended name: RING finger protein 170 Alternative name(s): Putative LAG1-interacting protein
Expression Region 1-258
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function E3 ubiquitin-protein ligase that plays an essential role in stimulus-induced inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) ubiquitination and degradation via the endoplasmic reticulum-associated degradation (ERAD) pathway. Also involved in ITPR1 turnover in resting cells.
Involvement in disease Ataxia, sensory, 1, autosomal dominant (SNAX1)
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Tissue Specificity Expressed in the spinal chord.
Database Links

HGNC: 25358

OMIM: 608984

KEGG: hsa:81790

STRING: 9606.ENSP00000434797

UniGene: Hs.491626

Related Products

RNF170 Antibodies

RNF170 Antibodies for Homo sapiens (Human)

RNF170 Proteins

RNF170 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.