Recombinant Human Retinoic acid receptor responder protein 1(RARRES1)

Code CSB-CF019341HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P49788
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Source in vitro E.coli expression system
Gene Names RARRES1
Protein Names Recommended name: Retinoic acid receptor responder protein 1 Alternative name(s): RAR-responsive protein TIG1 Tazarotene-induced gene 1 protein
Expression Region 1-294
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibitor of the cytoplasmic carboxypeptidase AGBL2, may regulate the alpha-tubulin tyrosination cycle.
Subcellular Location Membrane, Single-pass type III membrane protein
Protein Families Protease inhibitor I47 (latexin) family
Database Links

HGNC: 9867

OMIM: 605090

KEGG: hsa:5918

STRING: 9606.ENSP00000237696

UniGene: Hs.131269

Related Products

RARRES1 Antibodies

RARRES1 Antibodies for Homo sapiens (Human)

RARRES1 Proteins

RARRES1 Proteins for Homo sapiens (Human)

RARRES1 ELISA Kit

RARRES1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.