Recombinant Human Retinoic acid receptor responder protein 1 (RARRES1)

Code CSB-CF019341HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
RARRES1
Uniprot No.
Alternative Names
RARRES1; PEIG1; TIG1; Retinoic acid receptor responder protein 1; Phorbol ester-induced gene 1 protein; PERG-1; RAR-responsive protein TIG1; Tazarotene-induced gene 1 protein
Species
Homo sapiens (Human)
Expression Region
1-294
Target Protein Sequence
MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibitor of the cytoplasmic carboxypeptidase AGBL2, may regulate the alpha-tubulin tyrosination cycle.
Gene References into Functions
  1. TIG1 interacted with DNAJC8 in the cytosol, and this interaction completely blocked DNAJC8-mediated PKM2 translocation and inhibited glucose uptake. Furthermore, increased glycose uptake was observed in cells in which TIG1 was silenced. PMID: 29902837
  2. Data demonstrated that RARRES1 expression is lost in choriocarcinoma tumors due to promotor hypermethylation. Also, further results hypothesized that RARRES1 might be a negative regulator of EMT through induction of contact inhibition. PMID: 29169400
  3. Data show that retinoic acid receptor responder 1 (RARRES1) expression is subtype-dependent and regulated by DNA methylation and the expression of aldehyde dehydrogenase 1A3 (ALDH1A3). PMID: 27286452
  4. Data suggest that Retinoic Acid Receptor Responder (RARRES1)/ Tazarotene-induced gene-1 (TIG-1) may serve as a target for therapeutic intervention both in cancer and in angiogenesis-related disorders. PMID: 28678839
  5. Authors found that transmembrane protein 192 (TMEM192) interacted with TIG1. Authors also found that both TIG1A and TIG1B isoforms interacted and co-localized with TMEM192 in HtTA cervical cancer cells. The expression of TIG1 induced the expression of autophagy-related proteins. PMID: 27989102
  6. All-trans retinoic acid modulated secretion of RARRES1 in a dose dependent manner. PMID: 22942771
  7. our data suggested that epigenetic silencing of TIG1 gene expression by promoter hypermethylation may play an important role in hepatocellular carcinoma . PMID: 24006221
  8. High TIG1 expression is associated with inflammatory breast cancer through activation of Axl kinase. PMID: 24014597
  9. Analysis of a standard liver fibrosis model (CCl(4)) demonstrated an early induction of RARRES1 mRNA and protein expression. PMID: 22669512
  10. genotype-associated hypermethylation of the ETS-family target gene RARRES1 influences methylation at its neighbor gene LXN and could be useful as a prognostic biomarker. PMID: 22573467
  11. Knocking-down CTCF expression hampered RARRES1 expression. PMID: 22615834
  12. TIG1 suppressed PGE2-stimulated Wnt and cAMP signaling pathways in colon cancer cells through GRK5. PMID: 22126303
  13. GRK5 mediates cell growth suppression by TIG1A. Thus, TIG1 may participate in the downregulation of G-protein coupled signaling by upregulating GRK5 expression. PMID: 21575264
  14. The results of this study suggested that short RAI1 alleles might be releated to schizophreina disease. PMID: 21168224
  15. RARRES1, its interacting partners AGBL2, Eg5/KIF11, another EEY-bearing protein (EB1), and the microtubule tyrosination cycle are important in tumorigenesis. PMID: 21303978
  16. Silencing of TIG1 promoter by hypermethylation is common in human cancers and may contribute to the loss of retinoic acid responsiveness in some neoplastic cells. PMID: 15059893
  17. Hypermethylation of tazarotene-induced gene 1 is associated with gastric carcinogenesis PMID: 16134180
  18. TIG1 overexpression in SASC inhibited their differentiation into osteocytes and the expression of osteocalcin PMID: 19250291
  19. Findings suggest that TIG1 may play a role in cellular proliferation and invasion in NPC cells and that its function may be dependent on the EBV status. PMID: 19737656
  20. TIG1 undergoes frequent epigenetic inactivation due to aberrant DNA hypermethylation in gastric cancers. PMID: 19806788

Show More

Hide All

Subcellular Location
Membrane; Single-pass type III membrane protein.
Protein Families
Protease inhibitor I47 (latexin) family
Database Links

HGNC: 9867

OMIM: 605090

KEGG: hsa:5918

STRING: 9606.ENSP00000237696

UniGene: Hs.131269

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1