Recombinant Human Ribonuclease kappa (RNASEK)-VLPs

Code CSB-MP761293HU
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
RNASEK
Uniprot No.
Research Area
Others
Alternative Names
RNASEK; Ribonuclease kappa; RNase K; RNase kappa
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-137aa
Target Protein Sequence
MGWLRPGPRPLCPPARASWAFSHRFPSPLAPRRSPTPFFMASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endoribonuclease which preferentially cleaves ApU and ApG phosphodiester bonds. Hydrolyzes UpU bonds at a lower rate.; (Microbial infection) Required for the initial stages of clathrin-mediated endocytic uptake of a diverse set of viruses, including dengue, West Nile, Sindbis, Rift Valley Fever, and influenza viruses. Not required for clathrin-mediated endocytosis and macropinocytosis.
Gene References into Functions
  1. Low Rnase K expression is associated with prostate cancer. PMID: 30054827
  2. Analyses of global gene expression data from adipose tissue, skeletal muscle, and whole blood provide evidence that rs75493593 is associated with RNASEK gene expression, suggesting that RNASEK expression may mediate the effect of genotype on diabetes. PMID: 26487785
  3. RNASEK closely associates with the V-ATPase and is required for its function; its loss prevents the early events of endocytosis and the replication of multiple pathogenic viruses. PMID: 26212330
  4. Data suggest that the Cys6-Cys69 disulfide bond is likely to exist in all RNase kappa family members, including human. PMID: 22324914
  5. Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
  6. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086
  7. Based on sequence alignment and substrate specificity data, as well as the resistance of the protein to the placental ribonuclease inhibitor, the human RNase kappa may be a novel endoribonuclease distinct from other known ribonucleases. PMID: 17881363

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
RNase K family
Tissue Specificity
Widely expressed.
Database Links

HGNC: 33911

KEGG: hsa:440400

STRING: 9606.ENSP00000449500

UniGene: Hs.632232

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*