Recombinant Human SLP adapter and CSK-interacting membrane protein(SCIMP)

Code CSB-CF754405HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6UWF3
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKH KQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVS IPSYIEPEDDYDDVEIPANTEKASF
Source in vitro E.coli expression system
Gene Names SCIMP
Protein Names Recommended name: SLP adapter and CSK-interacting membrane protein Alternative name(s): SLP65/SLP76, Csk-interacting membrane protein
Expression Region 1-145
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Lipid tetraspanin-associated transmembrane adapter/mediator involved in major histocompatibility complex (MHC) class II signaling transduction. Required in generating the calcium response and enhancing ERK activity upon MHC-II stimulation.
Subcellular Location Membrane, Single-pass membrane protein, Membrane, Lipid-anchor
Tissue Specificity Expressed in antigen-presenting cells, like peripheral blood leukocytes and monocyte-derived dendritic cells (MDDC) (at protein level). Highly expressed in lymph nodes and spleen. Expressed in antigen-presenting cells. Faintly expressed in the majority of
Database Links

HGNC: 33504

OMIM: 614406

KEGG: hsa:388325

STRING: 9606.ENSP00000461269

UniGene: Hs.462080

Related Products

SCIMP Antibodies

SCIMP Antibodies for Homo sapiens (Human)

SCIMP Antibodies for Human

SCIMP Proteins

SCIMP Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.