Recombinant Human Sterol regulatory element-binding protein 2 (SREBF2), partial

Code CSB-CF621515HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SREBF2
Uniprot No.
Alternative Names
SREBF2; BHLHD2; SREBP2; Sterol regulatory element-binding protein 2; SREBP-2; Class D basic helix-loop-helix protein 2; bHLHd2; Sterol regulatory element-binding transcription factor 2
Species
Homo sapiens (Human)
Expression Region
1-484
Target Protein Sequence
MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGS GSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTS VPTTPRATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQV LQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVP VLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILT TMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGT DAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLK IEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRS RILL
Protein Length
Processed sterol regulatory element-binding protein 2 chain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 2), which is embedded in the endoplasmic reticulum membrane. Low sterol concentrations promote processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes involved in cholesterol biosynthesis.; Key transcription factor that regulates expression of genes involved in cholesterol biosynthesis. Binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC-3'). Regulates transcription of genes related to cholesterol synthesis pathway.
Gene References into Functions
  1. SREBF2 polymorphism rs2269657 showed significant dual associations with LOAD pathological biomarkers and gene expression levels. Furthermore, SREBF2 expression levels measured in LOAD frontal cortices inversely correlated with age at death; suggesting a possible influence on survival rate. PMID: 29503034
  2. SREBP-2 regulates autophagy-related gene expression in human liver cells. PMID: 29336468
  3. High SREBP-2 expression is associated with hypercholesterolemia. PMID: 29678744
  4. By altering the membrane trafficking through the lysosomes, cholesterol redistributes and regulates SREBP-2. PMID: 28696297
  5. The gene polymorphism of SREBP2 not only significantly associated with the clinical phenotypes of osteonecrosis of the femoral head but also closely related to lipid metabolism disorder. PMID: 28901487
  6. The current investigation indicated that the rs2267439C/T polymorphism in the SREBF-2 gene increased the T2D susceptibility in an Iranian population. PMID: 29601949
  7. Hexacosanol activates AMPK and hepatic autophagy and inhibits SREBP2, resulting in hypocholesterolemic activities and improvement of hepatic steatosis. PMID: 28676202
  8. CpG sites located in SREBF2 gene showed differential methylation in association with total cholesterol. The expression of the SREBF2 was inversely associated with methylation of its corresponding CpGs. PMID: 28173150
  9. Acidic pH-responsive SREBP2 target genes were associated with reduced overall survival of cancer patients. PMID: 28249167
  10. these clinical and experimental results reveal a novel role of SREBP-2 in the induction of a stem cell-like phenotype and prostate cancer metastasis PMID: 26883200
  11. These results seem to suggest an involvement of SREBF-2 in the integrity of white matter tracts in bipolar disorder and therefore a possible role of SREBP pathway in CNS myelination processes. PMID: 27771555
  12. High expression of SREBF2 is associated with high carotid intima-media thickness. PMID: 27841945
  13. mechanistic investigation provides clinical insights into protective roles of the epithelial cholesterol deficiency against excessive inflammatory responses via the SREBP2-HuR circuit, although the deficiency triggers transient pro-inflammatory signals. PMID: 27703009
  14. Dietary flavones counteract phorbol 12-myristate 13-acetate-induced SREBP-2 processing in hepatic cells. PMID: 27778136
  15. Identify a novel signaling pathway in hepatocytes triggered by ligand-activated p75NTR that via p38 MAPK and caspase-3 mediate the activation of SREBP2. This pathway may regulate LDLRs and lipid uptake particularly after injury or during tissue inflammation accompanied by an increased production of growth factors, including NGF and pro-NGF. PMID: 26984409
  16. The connections of EGFR and ERBB4 signaling with SREBP-2-regulated cholesterol metabolism are likely to be important in ERBB-regulated developmental processes and may contribute to metabolic remodeling in ERBB-driven cancers. PMID: 26535009
  17. knockdown of endogenous SREBP2 in HepG2 cells lowered ACSL1 mRNA and protein levels. PMID: 26728456
  18. Data suggest lysophosphatidylcholine (LPC) up-regulates SREBP-2 and cholesterol efflux in vascular endothelium; 25-hydroxycholesterol (25-HC) inhibits these effects of LPC; both LPC and 25-HC up-regulate release of interleukin-6 and interleukin-8. PMID: 25998247
  19. the results of the present study showed that luteolin modulates HMGCR transcription by decreasing the expression and nuclear translocation of SREBP-2. PMID: 26302339
  20. HCV core protein disturbs the cholesterol homeostasis in HepG2 cells via the SREBP2 pathway; miR-185-5p is involved in the regulation of SREBP2 by the core protein. PMID: 25914460
  21. the 5-aminoimidazole-4-carboxyamide ribonucleoside (AICAR)-induced activation of AMPK directly inhibited the expression of SREBP-2 and HMGCR and HMGCS, and suppressed the TSH-stimulated up-regulation of SREBP-2 in HepG2 cells. PMID: 25933205
  22. Suggest important role for SREBP-2 in regulation of lipid and glucose metabolism in hypertensive rats. PMID: 24908080
  23. Our results show that though leptin stimulates LDLR expression very weakly through JAK-STAT signaling pathway, it mainly imposes inhibition on LDLR expression by inhibiting transcription factor SREBP2 PMID: 25488447
  24. The results of this study suggested that the genetic polymorphisms of SREBF2 gene may be associated with metabolic syndrome in patients treated with clozapine. PMID: 25201120
  25. SREBP-2 rs2228314 G to C change and variant C genotype as well as LXRalpha rs11039155 G to A change and variant A may contribute to PCOS in Chinese Han population PMID: 25005769
  26. The SREBP-induced NOD-like receptor family pyrin domain-containing protein inflammasome and its instigation of innate immunity is an important contributor to atherosclerosis. PMID: 25188917
  27. The results of this study provide evidence that the GG genotype and G carrier (CG+GG) of rs2228314 G>C polymorphism in the SREBP-2 gene may increase the risk of NAFLD. PMID: 24992162
  28. findings suggest that SREBP2-miR-92a-inflammasome exacerbates endothelial dysfunction during oxidative stress PMID: 25550450
  29. SREBP-2 rs2228314 G to C change and variant C genotype may contribute to knee osteoarthritis risk in a Chinese Han population. PMID: 24496149
  30. Data show that forkhead transcription factor 4 (FoxO4) interacts with sterol regulatory element binding protein (SREBP)2 and hypoxia inducible factor (HIF)2alpha to modulate lanosterol 14alpha demethylase (CYP51) promoter activity. PMID: 24353279
  31. Rating SREBF2 polymorphism did not reveal a relationship to the occurrence of ischemic heart disease in patients with obstructive sleep apnea, both in the whole group as well as separate subgroups. PMID: 24868893
  32. A single nucleotide polymorphism that tags both the XRCC6 and SREBF2 genes strongly modifies the association between bladder cancer risk and smoking PMID: 24382701
  33. SREBP cleavage regulates Golgi-to-endoplasmic reticulum recycling of SREBP cleavage-activating protein (SCAP) PMID: 24478315
  34. These results suggest that SREBP-2 negatively regulates the FXR-mediated transcriptional activation of the FGF19 gene in human intestinal cells. PMID: 24321096
  35. Results suggested that interaction of SREBP-2 gene polymorphisms and the relationship between the polymorphisms and clinical phenotype of IGFBP-3 were closely related to increased ANFH risk in the Chinese population. PMID: 23158139
  36. Atheroprone flow induces NLRP3 inflammasome in endothelium through SREBP2 activation. PMID: 23838163
  37. Data indicate that SREBP-2 and Scap are regulated by factors driving prostate growth, and suggest exploring this observation further could shed light on prostate carcinogenesis. PMID: 23454642
  38. Starvation regulates endothelial lipase expression via SREBP-2. PMID: 23102786
  39. RNAi-mediated inhibition of SREBP2 expression significantly ameliorated the cholesterol accumulation induced by inflammatory cytokines in HepG2 cells. PMID: 23044239
  40. Results demonstrated, for the first time, the association of SREBP-2 with osteoarthritis pathogenesis and provided evidence on the molecular mechanism involved. PMID: 22662110
  41. Endoplasmic reticulum stress-induced SREBP-2 activation contributes to renal proximal tubule cell injury by dysregulating lipid homeostasis. PMID: 22573382
  42. SREBP-2 is directly linked as a target of amyloid-beta protein in cholesterol homeostasis impairment. PMID: 22573671
  43. SREBP-2 1784 G/C polymorphism is associated with non-alcoholic fatty liver disease in Asian Indians in north India. PMID: 22182810
  44. Linalool reduces the expression of 3-hydroxy-3-methylglutaryl CoA reductase via sterol regulatory element binding protein-2- and ubiquitin-dependent mechanisms. PMID: 21944868
  45. A combination oral contraceptive maintained a high-profile expression of LDLR through the stimulation of its transcription factor SREBP2 in primary placental trophoblasts and Jar cell line. PMID: 21757058
  46. could not identify any association between SREBF-2 1784G > C or SCAP 2386A > G SNPs and premature coronary artery disease or extent of coronary lesions in a Chinese population. PMID: 20111910
  47. results demonstrate for the first time that HIV-1 transcription in T cells is linked to cholesterol homeostasis through control of TFII-I expression by SREBP2 PMID: 21613400
  48. hepatic NPC1L1 in the liver from Chinese female gallstone patients may be mediated by SREBP2 PMID: 20144195
  49. miR-33 expression from an SREBP2 intron inhibits cholesterol export and fatty acid oxidation PMID: 20732877
  50. Data show that miR-33 is encoded within SREBP-2 and that both mRNAs are coexpressed. PMID: 20566875

Show More

Hide All

Subcellular Location
[Sterol regulatory element-binding protein 2]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 2]: Nucleus.
Protein Families
SREBP family
Tissue Specificity
Ubiquitously expressed in adult and fetal tissues.
Database Links

HGNC: 11290

OMIM: 600481

KEGG: hsa:6721

STRING: 9606.ENSP00000354476

UniGene: Hs.443258

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1