Recombinant Human Translocating chain-associated membrane protein 2(TRAM2)

Code CSB-CF624011HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q15035
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAFRRRTKSYPLFSQEFVIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFILPQYNISVPT ADSETVHYHYGPKDLVTILFYIFITIILHAVVQEYILDKISKRLHLSKVKHSKFNESGQL VVFHFTSVIWCFYVVVTEGYLTNPRSLWEDYPHVHLPFQVKFFYLCQLAYWLHALPELYF QKVRKEEIPRQLQYICLYLVHIAGAYLLNLSRLGLILLLLQYSTEFLFHTARLFYFADEN NEKLFSAWAAVFGVTRLFILTLAVLAIGFGLARMENQAFDPEKGNFNTLFCRLCVLLLVC AAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGT SPRTKKLKSP
Source in vitro E.coli expression system
Gene Names TRAM2
Protein Names Recommended name: Translocating chain-associated membrane protein 2
Expression Region 1-370
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Necessary for collagen type I synthesis. May couple the activity of the ER Ca(2+) pump SERCA2B with the activity of the translocon. This coupling may increase the local Ca(2+) concentration at the site of collagen synthesis, and a high Ca(2+) concentration may be necessary for the function of molecular chaperones involved in collagen folding. Required for proper insertion of the first transmembrane helix N-terminus of TM4SF20 into the ER lumen, may act as a ceramide sensor for regulated alternative translocation (RAT)
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families TRAM family
Database Links

HGNC: 16855

OMIM: 608485

KEGG: hsa:9697

STRING: 9606.ENSP00000182527

UniGene: Hs.520182

Related Products

TRAM2 Antibodies

TRAM2 Antibodies for Homo sapiens (Human)

TRAM2 Antibodies for Human

TRAM2 Proteins

TRAM2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.