Recombinant Human Translocation protein SEC62 (SEC62)

Code CSB-CF857446HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
SEC62; TLOC1; Translocation protein SEC62; Translocation protein 1; TP-1; hTP-1
Species
Homo sapiens (Human)
Expression Region
1-399
Target Protein Sequence
MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKE EDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLD GNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE TKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNG NDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates post-translational transport of precursor polypeptides across endoplasmic reticulum (ER). Proposed to act as a targeting receptor for small presecretory proteins containing short and apolar signal peptides. Targets and properly positions newly synthesized presecretory proteins into the SEC61 channel-forming translocon complex, triggering channel opening for polypeptide translocation to the ER lumen.
Gene References into Functions
  1. Results show higher SEC62 in the lymph node metastases from head and neck squamous cell carcinomas and cervical cancer of unknown primary patients compared with the primary tumor. Tumors from N1 to N3 stage exhibit increasing SEC62 expression in the lymphatic metastases. Its knockdown resulted in tumor cell line migration inhibition while, its overexpression stimulated cell migration. PMID: 28002801
  2. High Sec62 expression is associated with dysplastic cervical lesions. PMID: 27553742
  3. identify Sec62 as a critical molecular component in maintenance and recovery of endoplasmic reticulum homeostasis PMID: 27749824
  4. these studies identify TLOC1 and SKIL as driver genes at 3q26 and more broadly suggest that cooperating genes may be coamplified in other regions with somatic copy number gain. PMID: 23764425
  5. Sec62 overproduction significantly correlates with reduced non-small lung cancer patient survival. PMID: 24304694
  6. Phosphorylation of Sec63 by CK2 enhanced its binding to Sec62 PMID: 23287549
  7. Silencing the SEC62 gene inhibits post-translational transport of small presecretory proteins into endoplasmic reticulum. PMID: 22375059
  8. the Sec62-dependent translocation pathway serves as a fail-safe mechanism to ensure efficient secretion of small proteins and provides cells with an opportunity to regulate secretion of small proteins independent of the signal recognition particle pathway PMID: 22648169
  9. These results revealed that cyclin B1 and Sec62 may be candidate biomarkers and potential therapeutic targets for HBV-related HCC recurrence after surgery. PMID: 22682366
  10. The results indicate that SEC62 represents a potential candidate oncogene in the amplified 3q region in cases of non-small cell lung cancer. PMID: 22197383
  11. Our data indicate a crucial function of Sec62 in the response to thapsigargin-induced endoplasmic reticulum stress. PMID: 21557272
  12. after silencing of SEC62 the cell migration and the invasive potential of the cells was blocked or at least dramatically reduced while cell viability was hardly affected. SEC62 gene may indeed be considered a target gene in the therapy of various tumors PMID: 20669223
  13. The gene TLOC1/SEC62 revealed the highest frequency (50%) of copy number gains in the prostate cancer and was found to be up-regulated at the mRNA level. PMID: 16547154

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
SEC62 family
Database Links

HGNC: 11846

OMIM: 602173

KEGG: hsa:7095

STRING: 9606.ENSP00000337688

UniGene: Hs.744859

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1