Recombinant Human Transmembrane protein 165 (TMEM165)

Code CSB-CF023739HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TMEM165
Uniprot No.
Alternative Names
TMEM165; TPARL; Transmembrane protein 165; Transmembrane protein PT27; Transmembrane protein TPARL
Species
Homo sapiens (Human)
Expression Region
1-324
Target Protein Sequence
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAV QGPEPARVEKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIM AMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLK MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQA LTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTV TIIGGIVFLAFAFSALFISPDSGF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May function as a calcium/proton transporter involved in calcium and in lysosomal pH homeostasis. Therefore, it may play an indirect role in protein glycosylation.
Gene References into Functions
  1. High TMEM165 expression is associated with hepatocellular carcinoma. PMID: 30015898
  2. The finding of numerous splice variants could lead to a family of TMEM165 isoforms. PMID: 28088503
  3. Data indicate the Golgi protein transmembrane protein 165 (TMEM165) as a manganese-sensitive protein in mammalian cells. PMID: 28270545
  4. This manuscript is a review of the current state of knowledge on TMEM165 deficiencies in Congenital Disorders of Glycosylation as well as new data on function of TMEM165 and some speculative models on TMEM165/Golgi functions are discussed. PMID: 27401145
  5. Study not only provides novel insights into the molecular causes of glycosylation defects observed in TMEM165-deficient cells but also suggests that TMEM165 is a key determinant for the regulation of Golgi Mn(2+) homeostasis. PMID: 27008884
  6. Antisense oligonucleotide-mediated pseudoexon skipping used in a Golgi-resident protein, a promising treatment option for a specific TMEM165-congenital disorders of glycosylation. PMID: 24720419
  7. Congenital Disorders of Glycosylation disease-causing mutations of TMEM165 changes subcellular localization of the protein. PMID: 23575229
  8. Defects in TMEM165 affect both Ca2+ and pH homeostasis. PMID: 23569283
  9. we identified TMEM165 (also named TPARL) as a gene involved in congenital disorders of glycosylation (CDG). PMID: 22683087

Show More

Hide All

Involvement in disease
Congenital disorder of glycosylation 2K (CDG2K)
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane. Lysosome membrane. Early endosome membrane. Late endosome membrane.
Protein Families
GDT1 family
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 30760

OMIM: 614726

KEGG: hsa:55858

STRING: 9606.ENSP00000370736

UniGene: Hs.479766

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1