Recombinant Human Vacuole membrane protein 1 (VMP1)

Code CSB-CF856940HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
VMP1; TDC1; TMEM49; HSPC292; Vacuole membrane protein 1; Transmembrane protein 49
Species
Homo sapiens (Human)
Expression Region
1-406
Target Protein Sequence
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLE ILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLG ILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISL WSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDF ASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG ENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Phospholipid scramblase involved in lipid homeostasis and membrane dynamics processes. Has phospholipid scramblase activity toward cholesterol and phosphatidylserine, as well as phosphatidylethanolamine and phosphatidylcholine. Required for autophagosome formation: participates in early stages of autophagosome biogenesis at the endoplasmic reticulum (ER) membrane by reequilibrating the leaflets of the ER as lipids are extracted by ATG2 (ATG2A or ATG2B) to mediate autophagosome assembly. Regulates ATP2A2 activity to control ER-isolation membrane contacts for autophagosome formation. In addition to autophagy, involved in other processes in which phospholipid scramblase activity is required. Modulates ER contacts with lipid droplets, mitochondria and endosomes. Plays an essential role in formation of cell junctions. Upon stress such as bacterial and viral infection, promotes formation of cytoplasmic vacuoles followed by cell death. Involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis.; (Microbial infection) Host factor required for infection by all flaviviruses tested such as Zika virus and Yellow fever virus. Probably required post-entry of the virus to facilitate the ER membrane remodeling necessary to form replication organelles.
Gene References into Functions
  1. It has been concluded that VMP1-mediated autophagy cooperated with Kras to promote pancreatic ductal adenocarcinoma initiation. PMID: 27415425
  2. VMP1 modulates SERCA2 activity to control endoplasmic reticulum contacts for autophagosome formation. PMID: 28890335
  3. We hypothesize that in autophagy VMP1 is required for the correct morphogenesis of the omegasome by regulating MCS at the site of autophagosome formation. PMID: 27861594
  4. expression of TMEM49 seems to be associated with the apoptosis and metastasis up signaling pathways of ovarian cancer, and suppression of its expression can inhibit cancer cell growth and metastasis PMID: 27023910
  5. Study indicated that the expression of VMP1 was down-regulated and negatively correlated to the prognosis of colorectal cancer. PMID: 26328607
  6. In colorectal cancer cells, VMP1-dependent autophagy appears to be pro-survival rather than pro-cell death. PMID: 24365149
  7. in patients with invasive ductal carcinoma of the breast, Vmp1 expression had significant influence on disease-free survival time, with Vmp1-negative patients showing poor prognosis PMID: 23710913
  8. These results underscore a novel role for VMP1 as a potential therapeutic target for combinatorial therapies aimed at sensitizing pancreatic cancer cells to chemotherapeutic agents PMID: 23460482
  9. The VMP1-Beclin 1 interaction regulates autophagy induction. PMID: 23316280
  10. upregulation of Vmp1 was associated with suppression of growth and pulmonary metastases of HCC. PMID: 22971212
  11. AKT1-GLI3-VMP1 pathway mediates KRAS oncogene-induced autophagy in cancer cells. PMID: 22535956
  12. The expression of VMP1 had significant negative influence on the survival rate of non-small-cell lung cancer patients. PMID: 22333543
  13. VMP1 is reduced by hypoxia, and down-regulation of VMP1 by miR-210 mediates hypoxia-induced HCC cell metastasis. PMID: 22144109
  14. A fusion transcript (RPS6KB1-VMP1) recurrently expressed in 30% of breast cancers is associated with clinical consequences and may indicate genomic instability altering the expression of oncogenic components such as MIR21 and RPS6KB1. PMID: 21467264
  15. Zymophagy, a novel selective autophagy pathway mediated by VMP1-USP9x-p62, prevents pancreatic cell death. PMID: 21173155
  16. VMP1 knockdown decreased autophagy and apoptosis in gemcitabine-treated cancer cells PMID: 20299819
  17. Endogenously expressed Vmp1 is essentially a cell membrane protein that is involved in cell-cell adhesion, invasion and metastasis. PMID: 17724469
  18. VMP1 as a novel autophagy-related membrane protein involved in the initial steps of the mammalian cell autophagic process. PMID: 17940279
  19. Vacuole membrane protein 1 is an endoplasmic reticulum protein required for organelle biogenesis, protein secretion, and development PMID: 18550798

Show More

Hide All

Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
VMP1 family
Database Links

HGNC: 29559

OMIM: 611753

KEGG: hsa:81671

STRING: 9606.ENSP00000262291

UniGene: Hs.444569

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1