Recombinant Human Vacuole membrane protein 1(VMP1)

Code CSB-CF856940HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96GC9
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLE ILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLG ILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISL WSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDF ASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG ENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK
Source in vitro E.coli expression system
Gene Names VMP1
Protein Names Recommended name: Vacuole membrane protein 1 Alternative name(s): Transmembrane protein 49
Expression Region 1-406
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Plays a role in the initial stages of the autophagic process through its interaction with BECN1 (By similarity). Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions.
Subcellular Location Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Vacuole membrane, Multi-pass membrane protein, Endoplasmic reticulum
Protein Families VMP1 family
Database Links

HGNC: 29559

OMIM: 611753

KEGG: hsa:81671

STRING: 9606.ENSP00000262291

UniGene: Hs.444569

Pathway Autophagy

Related Products

VMP1 Antibodies

VMP1 Antibodies for Human

VMP1 Antibodies for Homo sapiens (Human)

VMP1 Proteins

VMP1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.