Recombinant Human Vesicle-associated membrane protein 1(VAMP1)

Code CSB-CF025780HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P23763
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT
Source in vitro E.coli expression system
Gene Names VAMP1
Protein Names Recommended name: Vesicle-associated membrane protein 1 Short name= VAMP-1 Alternative name(s): Synaptobrevin-1
Expression Region 1-118
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the targeting and/or fusion of transport vesicles to their target membrane.
Involvement in disease Spastic ataxia 1, autosomal dominant (SPAX1)
Subcellular Location Isoform 1: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome, SUBCELLULAR LOCATION: Isoform 2: Cytoplasmic vesicle membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome, SUBCELLULAR LOCATION: Isoform 3: Mitochondrion outer membrane, Single-pass type IV membrane protein
Protein Families Synaptobrevin family
Tissue Specificity Nervous system, skeletal muscle and adipose tissue.
Database Links

HGNC: 12642

OMIM: 108600

KEGG: hsa:6843

STRING: 9606.ENSP00000379602

UniGene: Hs.20021

Related Products

VAMP1 Antibodies

VAMP1 Antibodies for Homo sapiens (Human)

VAMP1 Antibodies for Human

VAMP1 Proteins

VAMP1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.