Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex(GPC),partial

Code CSB-CF362480LNP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P08669
Storage Buffer Tris-based buffer,50% glycerol
Species Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)
Sequence GTFTWTLSDSEGKDTPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFN KQAIQRLKAEAQMSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSKYWYLNHTTTGR TSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEMLQKEYMERQGKTPLGLVDLFVFSTS FYLISIFLHLVKIPTHRHIVGKSCPKPHRLNHMGICSCGLYKQPGVPVKWKR
Source in vitro E.coli expression system
Gene Names GPC
Protein Names Recommended name: Pre-glycoprotein polyprotein GP complexCleaved into the following 3 chains: 1. Stable signal peptide Short name= 2. SSP 3. Glycoprotein G1 Short name= 4. GP1 5. Glycoprotein G2 Short name= 6. GP2
Expression Region 260-491
Tag Info N-terminal 10xHis-tagged
Protein Description partial
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Stable signal peptide (SSP) is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion. The GP complex interacts with host glycosylated LAMP1 to mediate efficient infection.
Subcellular Location Stable signal peptide: Virion membrane, Multi-pass membrane protein, Host cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Glycoprotein G2: Virion membrane, Single-pass membrane protein, Host cell membrane, Single-pass membrane protein
Protein Families Arenaviridae GPC protein family
Database Links

KEGG: vg:956585

Related Products

GPC Antibodies

GPC Antibodies for Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

GPC Proteins

GPC Proteins for Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.