Recombinant Macaca mulatta Beta-2 adrenergic receptor(ADRB2)

Code CSB-CF635694MOW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q28509
Storage Buffer Tris-based buffer,50% glycerol
Species Macaca mulatta (Rhesus macaque)
Sequence MGQPGNGSAFLLAPNGSHAPDHDVTQERDEAWVVGMGIVMSLIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE AINCYAKETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF HAQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIPKEVYILLNWVGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKACGNGYSSNSNG NTGEQSGYHLEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRSCSTNDSLL
Source in vitro E.coli expression system
Gene Names ADRB2
Protein Names Recommended name: Beta-2 adrenergic receptor Alternative name(s): Beta-2 adrenoreceptor Short name= Beta-2 adrenoceptor
Expression Region 1-415
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Subcellular Location Cell membrane, Multi-pass membrane protein, Early endosome
Protein Families G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB2 sub-subfamily
Database Links

KEGG: mcc:710146

STRING: 9544.ENSMMUP00000002958

UniGene: Mmu.3441

Pathway Calcium signaling pathway
cAMP signaling pathway
cGMP-PKG signaling pathway

Related Products

ADRB2 Proteins

ADRB2 Proteins for Macaca mulatta (Rhesus macaque)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.