Product Details

Target Names

Slc25a4

Uniprot No.

Alternative Names

Slc25a4; Aac1; Anc1; Ant1; ADP/ATP translocase 1; ADP,ATP carrier protein 1; ADP,ATP carrier protein, heart/skeletal muscle isoform T1; Adenine nucleotide translocator 1; ANT 1; Solute carrier family 25 member 4

Species

Mus musculus (Mouse)

Expression Region

2-298

Target Protein Sequence

GDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSV QGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQ SGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

Protein Length

Full Length of Mature Protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane. In addition to its ADP:ATP antiporter activity, also involved in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. Plays a role in mitochondrial uncoupling by acting as a proton transporter: proton transport uncouples the proton flows via the electron transport chain and ATP synthase to reduce the efficiency of ATP production and cause mitochondrial thermogenesis. Proton transporter activity is inhibited by ADP:ATP antiporter activity, suggesting that SLC25A4/ANT1 acts as a master regulator of mitochondrial energy output by maintaining a delicate balance between ATP production (ADP:ATP antiporter activity) and thermogenesis (proton transporter activity). Proton transporter activity requires free fatty acids as cofactor, but does not transport it. Probably mediates mitochondrial uncoupling in tissues that do not express UCP1. Also plays a key role in mPTP opening, a non-specific pore that enables free passage of the mitochondrial membranes to solutes of up to 1.5 kDa, and which contributes to cell death. It is however unclear if SLC25A4/ANT1 constitutes a pore-forming component of mPTP or regulates it. Acts as a regulator of mitophagy independently of ADP:ATP antiporter activity: promotes mitophagy via interaction with TIMM44, leading to inhibit the presequence translocase TIMM23, thereby promoting stabilization of PINK1.

Gene References into Functions

The ANT1-deficient muscle mitochondria produce excess reactive oxygen species (ROS) and are partially uncoupled. Hence, the muscle respiration under nonphosphorylating conditions is increased. Muscle transcriptome analysis revealed the induction of mitochondrial biogenesis, down-regulation of diabetes-related genes, and increased expression of the genes encoding the myokines FGF21 and GDF15. PMID: 28223503
ANT1 can induce autoimmune myocarditis in A/J mice by generating autoreactive T cells. PMID: 27876151
miR-2861 and ANT1 are regulators of cardiomyocyte necrosis and myocardial infarction. PMID: 26654759
These results suggest that follicular helper T cells cells and IL-21 might be involved in the pathogenesis of viral myocarditis and play an important role in anti-ANT autoantibody production. PMID: 25889760
Data indicate that palmitoyl-carnitine (PC) increases the type 2 ryanodine receptor (RyR2) oxidation and reduces the ATP/ADP translocase (ANT) activity. PMID: 25619687
Downregulation of adenine nucleotide translocator 1 exacerbates tumor necrosis factor-alpha-mediated cardiac inflammatory responses. PMID: 25380814
Its mutation causes some inherited Parkinson disease. PMID: 24325796
Plasma membrane-localized ANT1 and ANT2 regulate L1-mediated neurite outgrowth in conjunction with MMP14. PMID: 22423112
Although the molecular mechanism linking ANT1-Cys(57) nitroalkylation and uncoupling is not yet known, these data suggest that ANT1-mediated uncoupling may be a mechanism for nitroalkene-induced cardioprotection. PMID: 22158628
The attenuation of ANT-1 in the presence of PGC-1alpha overexpression preserves the mitochondrial membrane potential in response to hydrogen-peroxide stress. PMID: 20600099
Data demonstrate that ANT1 protein levels are upregulated in Mecp2-null mice. PMID: 20504995
uncoupling protein-3 can minimize the induction of the adenine nucleotide translocase-mediated 'energy-wasting' process during Calorie restriction (CR). PMID: 20206124
The astrocytic response to CNS injury includes an apparent increase in energy mobilization capacity by Ant1 that contributes to neuroprotective, energy-dependent glutamate uptake PMID: 12781988
ANTs are non-essential structural components of the mitochondrial permeability transition pore, although they do contribute to its regulation PMID: 14749836
half to two-thirds of the basal proton conductance of mitochondria is catalysed by the adenine nucleotide carrier, independently of its ATP/ADP exchange or fatty-acid-dependent proton-leak functions PMID: 16076285
The ANT1 isoform may mediate a significant part of the high basal proton leak in brown-fat mitochondria. PMID: 16831128
The Ant1 deficient mouse skeletal muscle demonstrates that energy metabolism, antioxidant defenses, and apoptosis form an integrated metabolic network. PMID: 18439414
Cardiomyocyte-restricted overexpression of ANT1 prevents the development of diabetic cardiomyopathy; therefore, accelerated ADP/ATP exchange could be a new promising target to treat diabetic cardiomyopathy. PMID: 18945756
Inhibition by cyclosporin A prevents pyrazole plus lipopolysaccharide-induced liver injury PMID: 19026739
The mitochondrial membrane potential of Ant1-deficient brain mitochondria is increased and the permeability transition pore is more resistant to calcium induced permeability transition. PMID: 19366611
Data indicate that ANT mediates cell death, not through the MPT pore, but rather via a ROS-dependent upregulation and activation of Bax. PMID: 19452617

Hide All

Subcellular Location

Mitochondrion inner membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.

Protein Families

Mitochondrial carrier (TC 2.A.29) family

Tissue Specificity

Highly expressed in heart, skeletal muscle and brain.

Database Links

KEGG: mmu:11739

STRING: 10090.ENSMUSP00000034049

UniGene: Mm.16228

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF021510MO
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse ADP/ATP translocase 1 (Slc25a4)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage