Recombinant Mouse Arachidonate 5-lipoxygenase-activating protein (Alox5ap)

Code CSB-CF001625MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Alox5ap; Flap; Arachidonate 5-lipoxygenase-activating protein; FLAP; MK-886-binding protein
Species
Mus musculus (Mouse)
Expression Region
1-161
Target Protein Sequence
MDQEAVGNVVLLALVTLISVVQNAFFAHKVEHESKAHNGRSFQRTGTLAFERVYTANQNC VDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSFAGILNHYLIFFFGSDFENYIRTVSTTISPLLLIP
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Gene References into Functions
  1. ALOX5AP Overexpression in Adipose Tissue Leads to LXA4 Production and Protection Against Diet-Induced Obesity and Insulin Resistance PMID: 27207555
  2. Data indicate that a single amino acid mutation was sufficient to reverse the speciation observed in wild type 5-Lipoxygenase activating protein (FLAP). PMID: 27129215
  3. BRP-7 potently suppresses leukotriene biosynthesis by interacting with FLAP in mouse peritonitis model. PMID: 24641614
  4. FLAP regulates phosphorylation of tau protein via modulating GSK-3beta activity. PMID: 24301651
  5. This study demonistrated that a a novel role for FLAP in the pathogenesis of anxiety-like behavior in mice. PMID: 23357209
  6. Deletion of myeloid cell FLAP markedly attenuates the proliferative response to vascular injury, while preserving endothelial integrity. PMID: 23250985
  7. A FLAP inhibitor given during critical window periods may prevent oxygen induced aberration of pulmonary alveolarization in a dose- and time-dependent manner. PMID: 21052705
  8. the 5-LO pathway emerges early during embryonic stem cell differentiation into cells of the myeloid lineage PMID: 19965960
  9. Adipose tissue from obese mice, compared with that from lean mice, exhibited increased 5-LO activating protein PMID: 20207999
  10. Data show that 5-lipoxygenase activity increases during senescence-like growth arrest via a p53/p21-dependent pathway in both human and mouse embryo fibroblasts. PMID: 15616590
  11. Altered 5-lipoxygenase is associated with obesity and bone traits PMID: 16200066
  12. This observation supports the hypothesis that 5-LO may be involved in diseases of the brain associated with aging. PMID: 16930777
  13. Important role of FLAP/leukotriene pathway in adaptive immunological circuits in vascular and adipose tissue inflammation. May be key regulator of T-cell-driven inflammatory and possible target in treatment of atherosclerosis and metabolic disease. PMID: 17379835
  14. identify multiprotein complexes for leukotriene synthesis on the outer and inner nuclear membranes of mast cells and neutrophils, centered on the 5-Lipoxygenase-Activating Protein and 5-Lipoxygenase PMID: 19075240
  15. FLAP mRNA is abundantly expressed in fetal mouse liver from e11.5 until delivery. PMID: 19358825

Show More

Hide All

Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
MAPEG family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1