Recombinant Mouse Beta-2 adrenergic receptor (Adrb2)

Code CSB-CF001392MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Adrb2; Adrb2r; Beta-2 adrenergic receptor; Beta-2 adrenoreceptor; Beta-2 adrenoceptor
Species
Mus musculus (Mouse)
Expression Region
1-418
Target Protein Sequence
MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAK FERLQTVTNYFIISLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKK AIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF HAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRD NLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNG RTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTVPSLSVDSQGRNCSTNDSPL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Gene References into Functions
  1. we identified the beta2 adrenergic receptor (ADRB2) as a downstream target for PHD3 in skeletal muscle PMID: 28939592
  2. Here, the mechanism by which norepinephrine (NE)regulates prostate cancer DTCs in the marrow is explored. NE directly stimulated prostate cancer cell proliferation through beta2-adrenergic receptors (ADRB2).. NE also altered prostate cancer proliferation in the marrow niche by indirectly downregulating the secretion of the dormancy inducing molecule growth arrest specific-6 (GAS6) expressed by osteoblasts. PMID: 28814453
  3. Adrenergic Receptor beta-2 signaling in the airway epithelium promotes eosinophilic inflammation, mucous metaplasia, and airway contractility. PMID: 29073113
  4. this review discusses beta2-adrenoceptor function in asthma PMID: 28950943
  5. the present study demonstrated that cardiac contractility/relaxation and heart rate is increased in beta1AR TG and beta2AR TG mice, and indicated that this increase may be related to the overexpression of G proteins and Gproteinassociated proteins. PMID: 28487987
  6. S1928A KI mice failed to induce long-term potentiation in response to prolonged theta-tetanus (PTT-LTP), a form of synaptic plasticity that requires Cav1.2 and enhancement of its activity by the beta2-adrenergic receptor (beta2AR)-cAMP-PKA cascade. PMID: 28119465
  7. activation of beta2AR decreased cerebral amyloid plaques through the up-regulation of alpha-secretase activity and by decreasing the phosphorylation of APP at Thr668 PMID: 27838449
  8. Together, these data indicate that high-fat diet promotes phosphorylation of the beta2 AR, contributing to impairment of cardiac contractile reserve before cardiac structural and functional remodelling, suggesting that early intervention in the insulin-adrenergic signalling network might be effective in prevention of cardiac complications in diabetes PMID: 27983752
  9. beta2-AR deletion is associated to selective hepatic insulin resistance and preserved skeletal muscle insulin sensitivity. PMID: 28684080
  10. The diurnal variation of the humoral immune response was dependent on beta2AR-mediated neural signals and was diminished when lymphocyte recirculation through lymph nodes was stopped. PMID: 27799619
  11. knocking out of the beta1/2 receptor significantly diminished the ST25 acupuncture-induced inhibition of gastric motility and jejunal motility without significantly altering the enhancement of colonic motility induced by acupuncture at ST25. PMID: 27978539
  12. The authors show that phosphorylation of S1928 displaces the beta-2 adrenergic receptor from Cav1.2 upon beta-adrenergic stimulation rendering Cav1.2 refractory for several minutes from further beta-adrenergic stimulation. PMID: 27103070
  13. The Galphas and Galphaq peptides adopt different orientations in beta2-AR and V1AR, respectively. The beta2-AR/Galphas peptide interface is dominated by electrostatic interactions, whereas the V1AR/Galphaq peptide interactions are predominantly hydrophobic. PMID: 27330078
  14. Thus the beta2AR acts as a double-edged sword: increasing TAS2R14 cell surface expression, but when activated by beta-agonist, partially offsetting the expression phenotype by direct receptor:receptor desensitization of TAS2R14 function. PMID: 27342779
  15. Data show that inhibitory (Galphai2) and stimulatory (GalphasL) G-protein subunits produced minor atrophic and hypertrophic changes in muscle mass, and Galphai2 over-expression prevented AAV:beta2-adrenoceptor (beta2-AR) mediated hypertrophy. PMID: 26972746
  16. Age-related increase in hepatic triglyceride levels is reduced upon beta2-AR ablation. beta2-AR ablation improves glucose tolerance in old mice. PMID: 26952573
  17. Immune cell-expressed beta2AR plays an essential role in regulating the early inflammatory repair response to acute myocardial injury by facilitating cardiac leukocyte infiltration. PMID: 27364164
  18. In epileptic seizures mouse model, Pkdl deficiency leads to the loss of beta2AR on neuronal cilia, reduction in cAMP levels in the central nervous system, and reduction in the activation of cAMP response element-binding protein. PMID: 26612203
  19. Beta2AR overexpression enhances endothelial progenitor cells (EPC) functions in vitro and enhances the vascular repair abilities of EPCs in vivo via the beta2AR/Akt/eNOS pathway. PMID: 27194135
  20. Data show that beta2-AR plays an important role in prostate cancer metastasis formation. PMID: 26058426
  21. Inhibition of type 5 phosphodiesterase counteracts beta2-adrenergic signalling in beating cardiomyocytes. PMID: 25852085
  22. Housing temperature-induced stress drives therapeutic resistance in murine tumor models through beta2-adrenergic receptor activation. PMID: 25756236
  23. Quantification of beta adrenergic receptor subtypes in beta-arrestin knockout mouse airways. PMID: 25658948
  24. our results demonstrate that the beta2-adrenergic receptor is a key regulator of hepatic autophagy, and that the beta-blocker propranolol can independently induce a late block in autophagy. PMID: 24950230
  25. promotes the M2 macrophage phenotype in mouse models of endotoxemia and LPS-induced acute lung injury PMID: 24642449
  26. Lack of beta2 -adrenoceptors aggravates heart failure-induced skeletal muscle myopathy. PMID: 24629015
  27. This study demonstrated that TNFalpha plays a role in insulin resistance in beta2KO mice. PMID: 25138272
  28. Our results suggest that the beta2-adrenoceptor contributes to the regulation of the initial phases of muscle regeneration PMID: 24938737
  29. beta2AR-mediated signals inhibited lymph node egress of antigen-primed T cells and reduced their recruitment into peripheral tissues. PMID: 25422496
  30. role of beta-ARs in early muscle regeneration PMID: 25000590
  31. Adrenergic beta 2 receptor deficiency ameliorates tau pathology in a mouse model of tauopathies. PMID: 24626633
  32. Gene therapy or pharmacological means of increasing Galphas (or its coupling efficiency to beta2AR) thus represent an interface for development of novel therapeutic agents for improvement of beta-agonist therapy. PMID: 25260754
  33. Data indicate that adrenergic receptor beta2 activation modulates dendritic cells (DCs) function resulting in skewing towards anti-inflammatory T cell phenotypes. PMID: 24465481
  34. Beta-2-Adrenergic and M2-muscarinic receptors decrease basal t-tubular L-type calcium channel activity and suppress ventricular contractility in heart failure. PMID: 24389135
  35. These data indicate that increased insulin receptor signaling, may directly impair beta2-adrenergic receptor regulated cardiac contractility. PMID: 24677713
  36. specific interactions between the ligand and the Tyr-308 residue of beta2-AR stabilize receptor conformations favoring the receptor-Gs protein coupling and subsequently result in Gs-biased agonism. PMID: 24831005
  37. the cardio-protective effect of S-nitroso-N-acetylcysteine treatment is primarily through its anti-oxidant role and is associated with beta-ARs overexpression and beta-AR-SNO via an anti-apoptotic pathway PMID: 24333561
  38. The results of this study suggest that loss of beta2AR signalling results in a neuroprotective phenotype in part due to decreased NF-kappaB signalling, decreased inflammation and decreased apoptotic signalling in the brain. PMID: 22867428
  39. This study report that both beta1- and beta2-ARs are expressed in a majority of GABAergic interneurons in the medial prefrontal cortex of mice. PMID: 24215978
  40. Homotypic and heterotypic adhesion induced by odorant receptors and the beta2-adrenergic receptor. PMID: 24312457
  41. ADRB2 stimulation has caused a marked increase in the autophagy-targeted lipid droplets (LD) for lysosomal degradation, which is dependent on the LD-associated RAB7. PMID: 23708524
  42. Data indicate that adrenergic receptor beta2 knockout (ARbeta2KO) mice preserved cold- and diet-induced adaptive thermogenesis but disrupts glucose homeostasis. PMID: 24868110
  43. Disruption of gravin's scaffold mediated signaling is able to increase baseline cardiac function as well as to augment contractility in response to acute beta-AR stimulation. PMID: 24058627
  44. Data indicate that ischemic injury coupled to G protein-coupled receptor beta1/2 adrenergic receptors activation required GRK2 (GPCR kinase 2) activation. PMID: 24170934
  45. Deletion of the beta2-adrenergic receptor prevents the development of cardiomyopathy in mice. PMID: 23920331
  46. We demonstrate that beta2-adrenergic receptor-dependent activation of proinflammatory macrophages is critical for epinephrine-mediated IL-6 production in wound healing. PMID: 24121404
  47. the beta2-AR-HIF-1alpha axis regulates stress-induced pancreatic tumor growth and angiogenesis. PMID: 23745588
  48. GRK2 blockade with betaARKct is essential for cardiac beta2-adrenergic receptor signaling towards increased contractility. PMID: 23984976
  49. beta2-adrenergic receptor knockout mice exhibit A diabetic retinopathy phenotype. PMID: 23894672
  50. expression and function of beta(3)-adrenoceptors and beta(2)-adrenoceptors in mouse uterus PMID: 23219791

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome. Golgi apparatus.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB2 sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1