Recombinant Mouse C-X-C chemokine receptor type 1 (Cxcr1)

Code CSB-CF800386MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cxcr1; Il8ra; C-X-C chemokine receptor type 1; CXC-R1; CXCR-1; High affinity interleukin-8 receptor A; IL-8R A; CD antigen CD181
Species
Mus musculus (Mouse)
Expression Region
1-351
Target Protein Sequence
MAEAEYFIWTNPEGDFEKEFGNITGMLPTGDYFIPCKRVPITNRQALVVFYALVSLLSLL GNSLVMLVILYRRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSKLKGWIFGTPLCKMVSL LKEFNFFSGILLLACISVDRYLAIVHATRTLARKRYLVKFVCVGIWGLSLILSLPFAIFR QAYKPFRSGTVCYEVLGEATTDFRMTLRGLSHIFGFLLPLLTMLVCYGLTLRMLFKTHMR QKHRAMGVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIEDTCERRNDIDQALYITEILGF SHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEVLTHRRVAFHTSLTAIY
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. these studies define CXCR1 as a novel, noncanonical chemokine receptor that regulates pulmonary anti-Pseudomonas host defense with broad implications for cystic fibrosis, chronic obstructive pulmonary disease and other infectious lung diseases PMID: 26950764
  2. CXCR1 and CXCR2 regulate hepatocyte exosome release. The mechanism utilized by CXCR1 remains elusive, but CXCR2 appears to modulate Nsm activity and resultant production of ceramide to control exosome release. CXCR1 is required for packaging of enzymes into exosomes that mediate their hepatocyte proliferative effect. PMID: 27551720
  3. These data demonstrate a biological function for mouse Cxcr1 in vivo and indicate that CXCR1-dependent neutrophil effector function is a critical innate protective mechanism of fungal clearance and host survival in systemic candidiasis. PMID: 26791948
  4. in view of recently-published experimental data obtained in NOD mice, we argue for possible Cxcr1 involvement in type 1 diabetes pathogenesi PMID: 26230114
  5. expressed 33-110-fold higher in hepatocellular carcinoma polymorphonuclear myeloid-derived suppressor cells PMID: 25891236
  6. CXCR1 expression is induced in staphylococcus aureus-infected macrophages but not in control macrophages. PMID: 25129059
  7. Pharmacologic blockade of CXCR1/2 as well as genetic deletion of NAP-2 markedly reduced leukocyte shape change and intrathrombus migration. PMID: 23550035
  8. Blockade of the CXCL1-CXCR1/2 axis in mice improved intrahepatic islet engraftment. The CXCR1/2-mediated pathway is a regulator of islet damage. PMID: 22996693
  9. Upon activation by CXCL8, CXCR1 predominantly couples to G protein-coupled receptor kinase (GRK)2 to modulate leukocyte functions. PMID: 22869904
  10. Xiaotan Sanjie Decoction XTSJD can decrease the protein expressions of IL-8 and its receptors CXCR1/CXCR2 in tumor xenografts and gastric tissue adjacent to the tumor. PMID: 20082763
  11. data suggest that CXCR1 does not mediate the proliferative effects of ELR+ CXC chemokines during liver regeneration after partial hepatectomy PMID: 21693308
  12. CXCR1 expression is induced in hepatocytes after injury. Furthermore, the data suggest that CXCR1 has divergent effects from CXCR2 and appears to facilitate repair and regenerative responses after I/R injury. PMID: 21254176
  13. CX3CL1-CX3CR1 axis can regulate the expression of iNOS, a crucial mediator of DSS-induced colitis. PMID: 20335311
  14. mCXCR1 may mediate the recruitment of neutrophils to the inflammation site under certain infections PMID: 15967374
  15. The gene encoding mCXCR1-like was mapped to mouse chromosome 1 and its genomic organization was determined to be very similar to the organization of the gene encoding hCXCR1. PMID: 16084593
  16. CXCR1 is a functional receptor for GCP-2/CXCL6 and interleukin-8/CXCL8 in mouse PMID: 17197447
  17. CXCR1 cleavage on neutrophils disables bacterial killing in cystic fibrosis lung disease PMID: 18059279
  18. Blockade of CXCR1/CXCR2 receptors inhibits neutrophil recruitment by inhibiting the adhesion of neutrophils to synovial microvessels. As a consequence, there is decreased local cytokine production and ameloriation of arthritis in the tissue. PMID: 18668539

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1