Recombinant Mouse C-X-C chemokine receptor type 7 (Cxcr7)

Code CSB-CF006257MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ackr3; Cmkor1; Cxcr7; Rdc1; Atypical chemokine receptor 3; C-X-C chemokine receptor type 7; CXC-R7; CXCR-7; Chemokine orphan receptor 1; G-protein coupled receptor RDC1 homolog; RDC-1
Species
Mus musculus (Mouse)
Expression Region
1-362
Target Protein Sequence
MDVHLFDYAEPGNYSDINWPCNSSDCIVVDTVQCPTMPNKNVLLYTLSFIYIFIFVIGMI ANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKIT HLIFSINLFGSIFFLACMSVDRYLSITYFTGTSSYKKKMVRRVVCILVWLLAFFVSLPDT YYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFAVPFTIIAIFYFLLARAMS ASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILHYIPFTCQLENVLFTALHVT QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQN TK
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. Chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development.
Gene References into Functions
  1. CXCR7 gene overexpression promoted mesenchymal stem cell proliferation and migration, whereas suppressing CXCR7 had the opposite effect. PMID: 29317710
  2. Study shows that overexpression of CXCR7 in different cellular populations of endometriosis microenvironment may play a role in the pathogenesis and represent a novel target for treatment. PMID: 29587613
  3. endothelial CXCR7+ cells regulate CXCL12 gradient direction by controlling concentrations near but not far from the vasculature. PMID: 29117251
  4. High CXCR7 expression is associated with Prostate Cancer. PMID: 28687617
  5. the data identified the pivotal role of the receptor CXCR7 in pulmonary inflammation with a predominant effect on the pulmonary epithelium and polymorphonuclear neutrophils PMID: 28188248
  6. CXCR7 expression in adipose tissue macrophages is upregulated in obesity. PMID: 27693695
  7. Elevated expression of CXCR7 enhances endothelial progenitor cell resistance to diabetes mellitus-induced oxidative damage. PMID: 28137917
  8. expression of CXCR7 in normal and pathological nervous system suggests CXCR4-independent functions of SDF-1/CXCL12 mediated through its interaction with CXCR7 PMID: 25997895
  9. Endothelial CXCR7 limits breast cancer metastasis at multiple steps in the metastatic cascade, advancing understanding of CXCL12 pathways in tumor environments and informing ongoing drug development targeting CXCR7 in cancer. PMID: 26119946
  10. Sata demonstrate that CXCR7 has a role in the positioning of hem and pallium-subpallium boundary-derived Cajal-Retzius (CR)cells, CXCL12 regulating CR cell subpial localization through the combined action of CXCR4 and CXCR7. PMID: 25085881
  11. CXCR7 acts to prevent epithelial damage and ameliorate fibrosis after a single lung injury, repeated injury leads to suppression of CXCR7 expression and recruitment of VEGFR1 expressing macrophages, Wnt and Notch signaling, and enhanced fibrosis. PMID: 26779814
  12. CXCR7 overexpression in MSCs reversed the inhibitory effect of high concentrations of SDF-1alpha. PMID: 26303308
  13. Collectively, our data demonstrate that CXCR7 suppression modulates microglial chemotaxis to ameliorate EAE. PMID: 26607112
  14. Blockade of CXCR7 suppressed MIF-mediated ERK- and zeta-chain-associated protein kinase (ZAP)-70 activation PMID: 26139098
  15. Findings indicate that upregulation of CXCR7 expression is associated with tumor invasion in colorectal cancer. PMID: 25051350
  16. These findings identify CXCR7-mediated STAT3 activation and modulation of the tumor microenvironment as novel regulation of breast cancer growth and metastasis. PMID: 24886617
  17. CXCR7 has a role in modulating adrenomedullin-mediated cardiac and lymphatic vascular development PMID: 25203207
  18. CXCR7 plays a role in oligodendrocyte progenitor cell-maturation during remyelination. PMID: 24733828
  19. CXCR7 regulates blood cholesterol by promoting its uptake in adipose tissue. PMID: 24374972
  20. Genetic and pharmacologic experiments demonstrated that intermediate opioid peptides secreted from SCH activate CXCR7, a beta-arrestin-biased G-protein-coupled receptor, to augment circadian oscillation of glucocorticoid levels in a paracrine manner and CXCR7 ligand is sufficient to induce anxiolytic-like behavior. PMID: 24315101
  21. endothelial CXCR7 regulates circulating CXCL12 levels and that CXCR7 inhibitors might be used to block CXCL12-mediated cell migration for therapeutic purposes. PMID: 24116850
  22. CXCR7 is induced during monocyte-to-macrophage differentiation, which is required for SDF-1 and I-TAC signaling to JNK and p38 pathways, leading to enhanced macrophage phagocytosis PMID: 23599431
  23. Study suggests that the activation of CXCR7 on tumour blood vessels by its ligands may facilitate the progression of colorectal carcinoma (CRC) within lung but not within liver. PMID: 23169289
  24. Regulatory pathways targeting CXCR7 C-terminal serine/threonine sites may control the CXCL12 scavenger activity of CXCR7. PMID: 22736769
  25. Increase in CXCR7 expression is associated with muscular dystrophy. PMID: 22766125
  26. targeting CXCR7 modifies both disease severity and recovery during experimental autoimmune encephalomyelitis, suggesting a role for this molecule in both phases of disease. PMID: 22145790
  27. The CXCL11/CXCR7 pathway is involved hepatocellular carcinoma progression. PMID: 21778049
  28. These data indicate that SDF-1 is a key neuroprotective cytokine secreted by CD133-derived multipotent stromal cells that protects mouse neural progenitor cell through CXCR7. PMID: 20854168
  29. Data show that the SDF-1alphaCXCR7 signalling pathway regulates genes involved in cell cycle control, amino acid metabolism and ligase activity, which comprise targets that are distinct from those of CXCR4. PMID: 19302186
  30. Data suggest that CXCR7 is involved in semilunar valve development, possibly by regulating BMP signaling, and may contribute to aortic and pulmonary valve stenosis. PMID: 21246655
  31. CXCR7 influences leukocyte entry into the CNS parenchyma by controlling abluminal CXCL12 abundance during autoimmunity. PMID: 21300915
  32. Cxcr7 is necessary to regulate Cxcr4 protein levels, thereby adapting chemokine responsiveness in migrating cells. PMID: 21220100
  33. whereas CXCR7 protein is expressed by primitive RBCs during murine embryonic development, in adult mammals CXCR7 protein is not expressed by normal peripheral blood cells. PMID: 20889540
  34. CXCR7 is involved in neuronal cell migration and may act independently of CXCR4 as a mediator of CXCL12 signaling. PMID: 20681075
  35. CXCR7 regulates the invasion, angiogenesis and tumor growth of hepatocellular carcinoma cells PMID: 20380740
  36. Data show that beta-arrestin 2 increased uptake of CXCL12 in cells expressing CXCR7, emphasizing the functional relevance of the interaction between CXCR7 and beta-arrestin 2. PMID: 19794961
  37. Disfrupted cardiac development but normal hematopoiesis in mice deficient in Cxcr7. PMID: 17804806
  38. Seems to play an unimportant role in bone; however, an important role is indicated for CXCR7 in the cardiovascular system during embryonic and early postnatal development. PMID: 18442043

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region. Early endosome. Recycling endosome.
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Tissue Specificity
Not detected in blood, liver, lung and heart, but high expression detected in several tumor cell lines (at protein level). Expressed in heart, spleen, kidney, lung, ovary, brain, testis, astrocytes, neutrophils and B-lymphocytes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1