Recombinant Mouse Calcium release-activated calcium channel protein 1 (Orai1)

Code CSB-CF807422MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Orai1; Cracm1; Tmem142a; Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A
Species
Mus musculus (Mouse)
Expression Region
1-304
Target Protein Sequence
MHPEPAPPPSHSNPELPVSGGSSTSGSRRSRRRSGDGEPSGAPPLPPPPPAVSYPDWIGQ SYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPG LLIVFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAF STVIGTLLFLAEVVLLCWVKFLPLKRQAGQPSPTKPPAESVIVANHSDSSGITPGEAAAI ASTAIMVPCGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPG THYA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1. CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT. Plays a prominent role in Ca(2+) influx at the basolateral membrane of mammary epithelial cells independently of the Ca(2+) content of endoplasmic reticulum or Golgi stores. May mediate transepithelial transport of large quantities of Ca(2+) for milk secretion.
Gene References into Functions
  1. activation of TRPC1-based SOCs through a STIM1-activated PLCbeta1 pathway are likely to occur independently of Orai1 proteins PMID: 28301277
  2. SGK1 influences migration of VSMC by transcriptional regulation of Ca2+ channel Orai1 expression, an effect requiring SGK1-dependent activation of transcription factor NF-B after arterial injury. PMID: 28203685
  3. the declined Orai1 expression, at least partly, contributes to the downregulated Ca(2+) entry during lymphocyte excitation, providing an important mechanism for T lymphocyte malfunction in diabetes. PMID: 29654766
  4. SOCE was largely diminished in cells where STIM1 and/or ORAI1 had been silenced by small interfering (si)RNA. We conclude that extracellular ATP activates SOCE in white adipocytes, an effect predominantly mediated by STIM1 and ORAI1. PMID: 29335300
  5. Study shows that STIM1 and ORAI1 promotes membrane ruffling by showing that phospho-STIM1 localizes at the leading edge of cells, and that both phospho-STIM1 and ORAI1 co-localize with cortactin. PMID: 28341841
  6. Results show that Orai1 binds to the PRY-SPRY region of MG53 and co-localizes with MG53 in the plasma membrane in skeletal muscle which enhances extracellular Ca2+ entry via Orai1 by store-operated Ca(2+) entry mechanism. PMID: 27841305
  7. Silencing of beta 1 integrin gene regulates the gene expression of storeoperated Ca2+ entry (SOCE)-associated genes (STIM1, ORAI1 and TRPC1). PMID: 28656279
  8. Our study demonstrates that Orai1-Ca(2+)-calcineurin-NFATc4 signaling is an essential inflammatory pathway required for TNFalpha-induced endothelial cell activation and vascular inflammation. Therefore, Orai1 may be a potential therapeutic target for treatment of inflammatory diseases. PMID: 29223400
  9. Store-operated calcium entry via Orai1 in mesangial cells negatively regulates the TGF-beta1/Smad3 signaling pathway. PMID: 28637791
  10. Orai1 enhances muscle endurance by promoting fatigue-resistant type I fiber content PMID: 27587568
  11. Mouse embryos deficient in Orai1, Klf2, or Klf4 showed a significantly reduced lymphatic density and impaired lymphatic development. PMID: 28167653
  12. Store operated calcium entry negatively regulates the Smad1 signaling pathway and inhibits Col IV protein production in glomerular mesangial cells. PMID: 28298362
  13. F. vulgare fruits extract and its hexane fraction strongly blocked ORAI1 currents and tyrosinase activity and significantly inhibited UV-induced melanogenesis PMID: 27712859
  14. mice lacking acinar Orai1 exhibited intestinal bacterial outgrowth and dysbiosis, ultimately causing systemic translocation, inflammation, and death. PMID: 28273482
  15. these data indicate for the first time a functional interaction between Orai1, TRPC1, and CaV1.2 channels in Vascular Smooth Muscle Cells, confirming that upon agonist stimulation, vessel contraction involves Ca(2+) entry due to co-activation of Orai1- and TRPC1-dependent store-operated Ca(2+) channels and L-type Ca(2+) channels. PMID: 27535226
  16. reveal that Orai1(-/-) male mice are sterile and have severe defects in spermatogenesis, with prominent deficiencies in mid- to late-stage elongating spermatid development PMID: 26969191
  17. In Dicer-deficient mice Orai1 was down-regulated at mRNA and protein level in CD4+ T cells. PMID: 27607422
  18. results identified the ORAI-NOX2 feedback loop as a determinant of monocyte immune responses. PMID: 26956485
  19. Orai1-dependent Ca(2+) entry promotes atherogenesis possibly by promoting foam cell formation and vascular inflammation, rendering orai1 Ca(2+) channel a potential therapeutic target against atherosclerosis. PMID: 26916730
  20. strong expression during the ameloblast secretory stage PMID: 26178077
  21. alternative translation initiation of the Orai1 message produces at least three types of Ca(2+) channels with distinct signaling and regulatory properties. PMID: 26221052
  22. Orai1 and STIM1 have roles in inhibiting matrix protein expression PMID: 25788524
  23. SOCE blockers or ablation of STIM1, STIM2, or Orai1 severely impaired nucleotide-induced migration and phagocytosis in microglia. PMID: 25471906
  24. Our data establish Orai1 as key signal mediator of C5aR activation, contributing to inflammation PMID: 25912155
  25. Orai1 store-operated calcium channels have an essential role in lactation PMID: 25902527
  26. TRPC6 activity can occur independently of the physical interaction with Orai1 PMID: 24520961
  27. Data show that increased activity of STIM1-Orai1 complex inducing enhanced Ca(2+) influx is a disease determinant in muscular dystrophy. PMID: 24556214
  28. STIM1, STIM2, and CRAC channel function play distinct but synergistic roles in CD4+ and CD8+ T cells during antiviral immunity PMID: 25157823
  29. The calcium release-activated calcium channel Orai1 represents a crucial component in hypertrophic compensation and the development of dilated cardiomyopathy PMID: 24135962
  30. Data indicate that STIM1 is involved in both early neural differentiation of ES cells and survival of early differentiated ES cells independent of Orai1-mediated SOCE. PMID: 24424349
  31. These studies indicate a critical role for Orai1-mediated SOCE in lacrimal gland signalling and function. PMID: 24297846
  32. Store-operated Ca(2+) entry was lost in embryonic and adult mouse neural progenitor cells from transgenic mice lacking Orai1 or STIM1 and in knock-in mice expressing the loss-of-function Orai1 mutant R93W. PMID: 24990931
  33. Inhibition of Orai1 induces skin atrophy and decreases epidermal proliferation in mice PMID: 24317393
  34. Lactation is associated with the enhancement of basal Ca2+ influx that appears to occur through the calcium channel Orai1. PMID: 24359162
  35. The AMPK alpha1 sensitive Ca2+ entry is abrogated by Orai1 blocker 2-APB. PMID: 24080823
  36. T cells expressing ORAI1-DN lacked TCR activation induced [Ca(2+)]i elevation, yet arrested motility similar to control T cells in vitro. PMID: 23939929
  37. Orai1 protein is mainly confined to the basal layer of epidermis where it plays a critical role to control keratinocyte proliferation and polarized motility. PMID: 24277812
  38. Data indicate that the Ca(2+) release-activated Ca(2+) channels (CRAC) blocker GSK-7975A inhibited store-operated Ca(2+) entry in a concentration-dependent manner. PMID: 23878235
  39. ORAI1 is the main calcium entry mechanism during oxidative glutamate toxicity, suggesting that SOCE inhibition might be a valuable tool in the treatment of diseases associated with increased oxidative stress. PMID: 23348584
  40. Our data indicates that upregulation of the Orai1-mediated SOCE pathway and an overloaded SR Ca(2+) store contributes to the disrupted Ca(2+) homeostasis in mdx muscles and is linked to elevated proteolytic activity PMID: 23185465
  41. Orai1 function is essential for T cell homing to lymph nodes. PMID: 23455504
  42. The Orai1-mediated Store-operated Ca(2+) entry plays a crucial role in the mineralization of osteoblasts by regulating expression of bone matrix protein. PMID: 23122304
  43. Orai-1 protein level is greatly upregulated in airway smooth muscle cells from asthmatic mice. PMID: 23014880
  44. The data provided direct evidence that TRPC1 and Orai1 channels mediate capacitative calcium entry through activation of STIM1 in acute hypoxic mouse pulmonary arterial smooth muscle cells. PMID: 23034388
  45. Micro-CT showed reduced cortical ossification and thinned trabeculae in Orai1(-/-) animals compared with controls; bone deposition was markedly decreased in the knockout mice. This suggests a previously unrecognized role for Orai1 within osteoblasts. PMID: 22546867
  46. intracellular alkalinization inhibits SERCA activity, activating store-operated channels (SOCs) of Orai1 and Stim1, leading to increased Ca(2+) influx PMID: 22384096
  47. ORAI1 is involved in the Ca(2+) entry pathway in the mature oocyte. PMID: 22053056
  48. Downregulation of Orai1 expression in the airway, adminestering recombinant lentivirus vectors that encoded shRNA against ORAI1, alleviated symptoms of allergic rhinitis in mice. PMID: 22170034
  49. Hypertrophy in skeletal myotubes induced by junctophilin-2 mutant, Y141H, involves an increase in store-operated Ca2+ entry via Orai1. PMID: 22389502
  50. Results indicate that Orai1 plays a critical role in the differentiation and function of osteoclasts, by regulating activation of the transcription factor NFATc1. PMID: 22198385

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Protein Families
Orai family
Tissue Specificity
Expressed in lactating mammary epithelium (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1