Recombinant Mouse Ceramide synthase 1(Cers1)

Code CSB-CF012761MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P27545
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MAAAAATPRLEAPEPMPSYAQMLQRSWASALAAAQGCGDCGWGLARRGLAEHAHLAAPEL LLAVLCALGWTALRWAATTHIFRPLAKRCRLQPRDAARLPESAWKLLFYLACWSYCAYLL LGTSYPFFHDPPSVFYDWRSGMAVPWDIAVAYLLQGSFYCHSIYATVYMDSWRKDSVVML VHHVVTLLLIASSYAFRYHNVGLLVFFLHDVSDVQLEFTKLNIYFKARGGAYHRLHGLVA NLGCLSFCFCWFWFRLYWFPLKVLYATCHCSLQSVPDIPYYFFFNILLLLLMVMNIYWFL YIVAFAAKVLTGQMRELEDLREYDTLEAQTAKPCKAEKPLRNGLVKDKLF
Source in vitro E.coli expression system
Gene Names Cers1
Protein Names Recommended name: Ceramide synthase 1 Short name= CerS1 Alternative name(s): LAG1 longevity assurance homolog 1 Longevity assurance gene 1 protein homolog 1 Protein UOG-1
Expression Region 1-350
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Tissue Specificity Brain-specific.
Database Links

KEGG: mmu:93898

STRING: 10090.ENSMUSP00000120598

UniGene: Mm.258280

Related Products

Cers1 Proteins

Cers1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.