Recombinant Mouse D (3) dopamine receptor (Drd3)

Code CSB-CF007180MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Drd3
Uniprot No.
Alternative Names
Drd3; D(3 dopamine receptor; Dopamine D3 receptor
Species
Mus musculus (Mouse)
Expression Region
1-446
Target Protein Sequence
MAPLSQISSHINSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYMVLRQRRRKRILTRQNSQCISIRPGFPQ QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKPYPQKCQDPLLSHLQPLSPGQTHGELK RYYSICQDTALRHPNFEGGGGMSQVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLKLGP LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV NSALNPVIYTTFNIEFRKAFLKILSC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
Gene References into Functions
  1. This study demonstrated that D3 receptor deficiency has sex-specific effects on wheel running activity during training and plateau phases. PMID: 28684358
  2. The dopamine D3 receptor affects nociceptive behaviors in a sex-specific manner and its absence induces more analgesic behavior in female knock-out mice. PMID: 27716994
  3. The D3 dopamine receptor, a member of the Gi-coupled D2 family of dopamine receptors, are expressed throughout limbic circuits, including prefrontal cortex (PFC). PMID: 28522735
  4. this study shows that DRD3 signaling evokes suppressor of cytokine signaling 5 expression, a negative regulator of Th2 development, which indirectly favors acquisition of Th1 phenotype PMID: 27183640
  5. this study shows that D3R regulates the effect of methamphetamine on LPS-induced mast cells activation PMID: 27156126
  6. This study show the Genetic blockade of the dopamine D3 receptor enhances hippocampal expression of PACAP and receptors and alters their cortical distribution. PMID: 26718601
  7. Results suggest that the dopamine D3 receptor is centrally involved in the etiology of adult anxiety- and depression-related behaviors that arise from repeated stressful experiences during childhood. PMID: 26619275
  8. D3R modulates GABAA receptors function in striatum: chronic blockade of D3R increases alpha6 subunit expression and induces insensitivity to the anxiolytic effect of diazepam PMID: 25482686
  9. Study identified a unique role for Npas2 in the regulation of cocaine reward and dopamine Drd3 receptor expression PMID: 25444159
  10. Results suggest that D3 receptors and related signaling mechanisms play key roles in reconsolidation of cocaine memories in mice, and that these receptors may serve as novel targets for the treatment of cocaine abuse in humans. PMID: 25149631
  11. D5 regulate CD4(+)T-cell activation and differentiation by modulating ERK activation and cAMP production. PMID: 26025054
  12. Overexpression of D3Rs in the striatum of mice does not elicit cognitive deficits but disrupts motivation, suggesting that changes in D3Rs may be involved in the negative symptoms of schizophrenia. PMID: 24387821
  13. This study demonstrated that Low dose pramipexole causes D3 receptor-independent reduction of locomotion and responding for a conditioned reinforce/ PMID: 25283483
  14. D3R deficiency results in anxiety-like and depressive-like symptoms that cannot be attributed to motor dysfunction. PMID: 25110304
  15. This study demonstrated that dopamine D3 receptor is necessary for ethanol consumption in mice. PMID: 24584330
  16. Our data suggest that the D3 receptor modulates the mu opioid receptor system in the spinal cord, and that a dysfunction of the D3 receptor can induce a morphine-resistant state. PMID: 24966815
  17. data supports the notion that D3Rs might modulate CREB phosphorylation after acquisition of PA, probably via activation of ERK signaling PMID: 24100927
  18. The dopamine D3 receptor has a critical role in the emergence of aging-related cardiac fibrosis, remodeling, and dysfunction. PMID: 24023697
  19. our finding reveals that mice lacking D3Rs show enhanced tissue plasminogen activator proteolytic activity on BDNF PMID: 23906635
  20. The findings of this study suggested that D3Rs play an important role in mediating cocaine's rewarding effects. PMID: 23643749
  21. These results suggest that D3 receptors play a key role in reconsolidation of cocaine-induced conditioned place preference in mice PMID: 23506736
  22. This study demonistrated that D3 receptor-deficient mice displayed attenuated MPTP-induced locomotor activity changes. Consistent with the behavioral observations PMID: 23902361
  23. Dopamine D3 receptor activation increases neural stem cell numbers in adult subventricular zone neurospheres from wild-type but not D3R knock-out mice. . PMID: 23322492
  24. In female mice, knockout of the dopamine D3 receptor had no effect on spatial working memory (SWM) in the Sham groups, but had a positive effect on SWM in the OVX groups. PMID: 23511253
  25. The renal D5R protein upregulation was not caused by increased transcription because renal mRNA expression of D5R was similar in D3(-/-) and D3(+/+) mice. PMID: 23753418
  26. The binding of the REV-ERBalpha protein to the DRD3 promoter increased in the early dark phase. PMID: 23429911
  27. Mice lacking D3 receptor might be more resistant to stressful procedures. PMID: 23357086
  28. The glutamate-D(3) receptor interactions described here offer a conceptual framework for developing new D(3) receptor-selective drugs, which may appear as an original, efficacious, and safe way to potentially indirectly target glutamate in schizophrenia PMID: 23001156
  29. These findings indicate that D3R expressed on CD4(+) T cells plays a fundamental role in the physiopathology of MPTP-induced Parkinson's disease in a mouse model. PMID: 23589621
  30. The stimulation of D3R transiently activates the Akt/GSK-3beta pathway in the two populations of medium-size spiny neurons of the nucleus accumbens and dorsal striatum. PMID: 23410496
  31. D3 receptor activation results in changes in intracellular [Ca(2+)] dynamics, which, in turn, lead to lowered insulin secretion. PMID: 22918877
  32. The present data do not support a necessary role for the D3 receptor in the direct reinforcing effects of cocaine PMID: 22867038
  33. The results of this study suggested a role for the DA D3 receptor in pain modulation and identify the D3KO as a possible model for increased nociception. PMID: 22995602
  34. These observations suggest that D3 receptors exert a tonic, constitutive inhibitory influence upon adult hippocampal neurogenesis. PMID: 22957735
  35. findings suggest that D(3)R deletion increases vulnerability to cocaine, and that reduced D(3)R availability in the brain may constitute a risk factor for the development of cocaine addiction PMID: 23045656
  36. The dopamine D3 receptor knock-out mice developed lower morphine-induced tolerance and showed attenuated withdrawal signs compared with the wild-type mice. PMID: 22154407
  37. These results suggest that D3 receptors modulate locomotor responses to both acute and repeated METH treatment. PMID: 22420045
  38. The present study identified the DR subtype as the most important receptor of the dopaminergic system to modulate intraocular pressure with relevant implications for glaucoma that represents one of the most crippling optic neuropathies. PMID: 22178719
  39. This study demonistrated that synergic effect of DRD3 polymorphisms on schizophrenia susceptibility. PMID: 21737144
  40. A single bilateral intrastriatal BDNF infusion is sufficient to rescue the reduced expression of dopamine receptor D3R. PMID: 20938680
  41. This study demonistrated that the role of D3R as a regulator of dopaminergic effects in learning and attention processes. PMID: 21354213
  42. Results show a correlation among the dopamine D3 receptor, neurofibromin 1 and amyloid precursor protein in mouse brains and thus show the regional-specific regulation of NF1 in brains of D(3)R KO. PMID: 21170735
  43. Dopamine D1 but not D3 receptor is critical for spatial learning. PMID: 20600656
  44. The results of this study confirmed the ability of iron deficiency and D3R-/- to evoke sensory and motor symptoms in mice resembling those observed in RLS patients PMID: 21209191
  45. D(3) receptor-regulated cAMP-response element binding protein signaling in the hippocampus may be involved in these age-associated alterations. PMID: 20600590
  46. Dopaminergic stimulation of D3R drives proliferation via rapidly amplifying progenitor cells to promote murine subventricular zone neurogenesis. PMID: 20477937
  47. D3R(-/-) mice exhibited a better basal cognitive performance as compared to WT mice (p < 0.001). PMID: 20149873
  48. Amphetamine can produce significant conditioned place preference in dopamine D3 receptor knock-out mice. PMID: 18402112
  49. Mice lacking dopamine D3 receptors have spatial working memory deficits PMID: 12097513
  50. D3 activation of GIRK currents in substantia nigra neurons does not occur or is exceedingly rare PMID: 12843272

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1