Recombinant Mouse D (4) dopamine receptor (Drd4)

Code CSB-CF007181MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Drd4
Uniprot No.
Alternative Names
Drd4; D(4 dopamine receptor; D(2C dopamine receptor; Dopamine D4 receptor
Species
Mus musculus (Mouse)
Expression Region
1-387
Target Protein Sequence
MGNSSATEDGGLLAGRGPESLGTGAGLGGAGAAALVGGVLLIGLVLAGNSLVCVSVASER TLQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVASPVVCGLNDVPGRDPAVC CLENRDYVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV SDPTQGPFFPDCPPPLPSLRTSPSDSSRPESELSQRPCSPGCLLADAALPQPPEPSSRRR RGAKITGRERKAMRVLPVVVGAFLVCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN SALNPIIYTIFNAEFRSVFRKTLRLRC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dopamine receptor responsible for neuronal signaling in the mesolimbic system of the brain, an area of the brain that regulates emotion and complex behavior. Activated by dopamine, but also by epinephrine and norepinephrine, and by numerous synthetic agonists and drugs. Agonist binding triggers signaling via G proteins that inhibit adenylyl cyclase. Modulates the circadian rhythm of contrast sensitivity by regulating the rhythmic expression of NPAS2 in the retinal ganglion cells.
Gene References into Functions
  1. data imply that enhanced D4 receptor-mediated dopaminergic control of corticostriatal transmission constitutes a vulnerability factor of ADHD and other neuropsychiatric disorders. PMID: 28097219
  2. Results indicate that the full rescue of impaired LTP in aging is achieved by the selective D4R activation. PMID: 28975698
  3. over-suppression of NMDAR function may underlie the role of hD4.7 in attention deficit hyperactivity disorder PMID: 27475724
  4. The G-protein coupled receptor, DRD4, requires ARR1 and ARR4 for desensitization and internalization. PMID: 26169958
  5. This study demonstrated that dopamine D4 receptor gene has an important role in increased exploratory and anxiolytic behavior only in males and these behaviors were positively correlated with increased alcohol consumption. PMID: 25914336
  6. Contrast sensitivity is reduced in Drd4-/- mice. PMID: 24048828
  7. dopaminergic modulation of early long-term potentiation in stratum oriens occurs through NMDA receptors containing NR2B subunits via D4Rs PMID: 21955919
  8. Data demonstrate that stimulating the dopamine Dreceptor is essential in maintaining the normal rhythmic production of adenylyl cyclase 1 from transcript to enzyme activity. PMID: 21676039
  9. This study demonistrated that the dopamine D4 receptor is the role of attention. PMID: 21458500
  10. The result of this study demonistrated that the dopamine drd4 receptor appears to be important for specific exploration. PMID: 21412225
  11. Data suggest that dopamine D4 receptors modulate not only the prefrontal cortex, but also the cerebellar vermis, which may reflect an indirect modulation as D4Rs are minimally expressed in this region. PMID: 20646063
  12. no connection between analysed polymorphism of genes: DRD2, DRD3, DRD4, DAT, COMT and schizophrenia was stated. PMID: 20672519
  13. This result suggests an effect of 5-HTTLPR on externalizing behavior in the presence of DRD4 7r but no effect in its absence. PMID: 19696961
  14. absence of D4Rs increases avoidance behaviour to unconditioned stimuli and does not impair behavioural reactions to Pavlovian fear-conditioning PMID: 11860516
  15. Postsynaptic activation of dopamine D4 receptors reduces GABAergic currents in globus pallidus neurons. PMID: 14684868
  16. D4R signaling is essential for the expression of juvenile hyperactivity and impaired behavioral inhibition, relevant features present in this attention deficit disorder-like mouse model. PMID: 14699433
  17. The findings suggest that D1, D4, and NMDA receptors may interact functionally and that developmental absence of D4 receptors might trigger compensatory mechanisms that enhance expression of D1 receptors PMID: 14997010
  18. D4 dopamine receptor is found to be expressed in the subcommissural organ (SCO), an ependymal brain gland that is located in the roof of the third ventricle. PMID: 15197646
  19. Absence of dopamine D4 receptor increases blood pressure, possibly via increased angiotensin II type 1 receptor expression. PMID: 16380537
  20. Dopamine D4 receptor knockout mice exhibit neurochemical changes consistent with decreased dopamine release. PMID: 17449106
  21. KLHL12 specifically interacts with the D4 polymorphism, thereby building up a Cul3-E3 ligase complex with substrate specificity toward the D4 receptor PMID: 18303015
  22. absence of D4R is not sufficient to cause psychopathologies associated with heightened impulsivity and novelty seeking PMID: 18456309
  23. data indicate that the DRD4 receptor is involved in modulation of glutamate neurotransmission, primarily in the striatum PMID: 18536704
  24. Drd4 activation is required for normal expression of adenylyl cyclase type 1 and for regulation of its catalytic activity by light. PMID: 19166506
  25. D(4) dopamine receptor differentially regulates Akt/nuclear factor-kappaB and extracellular signal-regulated kinase pathways in D(4)MN9D cells. PMID: 11562449

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in olfactory bulb, hypothalamus, olfactory tubercle, brainstem and striatum.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1