Recombinant Mouse Delta-type opioid receptor (Oprd1)

Code CSB-CF016358MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Oprd1; Delta-type opioid receptor; D-OR-1; DOR-1; K56; MSL-2
Species
Mus musculus (Mouse)
Expression Region
1-372
Target Protein Sequence
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC TPSDGPGGGAAA
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine.
Gene References into Functions
  1. DOR regulates the reinforcing effects and motivation for palatable food through neuroplastic changes in specific brain reward areas. PMID: 27101941
  2. Knockout mice for mu and delta opioid receptor have augmented colon sensitivity in the colonic distension assay. PMID: 27748566
  3. Suggest that oxycodone by itself can activate both the mu- and delta-opioid receptors and that delta-opioid receptors may contribute to the central antinociceptive effect of oxycodone in mice. PMID: 27496654
  4. it showed that the antinociception of ghrelin was correlated with the GHS-R1alpha and d-opioid receptors. Finally, the antinociception induced by deltorphin II wasn't blocked by the co-injection (i.c.v.) of [D-Lys(3)]-GHRP-6, indicating that the GHS-R1a isn't on the backward position of delta opioid receptor. PMID: 27474249
  5. data provide evidence for genetic modulation of opioid withdrawal severity. PMID: 26692286
  6. Agonists that bind to the same receptor can produce highly distinct signaling events and arrestins are a major mediator of this ligand bias. PMID: 27013682
  7. Delta opioid receptor (DOR) expressed in the forebrain mediate the described locomotor effect of SNC80 (DOR agonist) and inhibit D1-stimulated hyperactivity. Data also reveals an anxiogenic role for this particular DOR subpopulation. PMID: 25444168
  8. In the forebrain, delta-opioid receptors are mainly detected in separate neurons. In contrast, neuronal co-localization is detected in subcortical networks. PMID: 24623156
  9. Anti-nociception mediated by a KOR agonist is blocked by a DOR agonist PMID: 24923251
  10. Activation of the delta opioid receptor promotes cutaneous wound healing by affecting keratinocyte intercellular adhesion and migration PMID: 24628261
  11. delta-Opioid receptors in the accumbens shell mediate the influence of both excitatory and inhibitory predictions on choice PMID: 24758591
  12. we have demonstrated for the first time that DOR receptor activation induces astrocytic expression of EAAT1 and EAAT2 PMID: 25052197
  13. The results of this study indicated that delta-opioid receptor have a differential role in cue-induced reinstatement of cocaine-seeking behavior. PMID: 24943644
  14. Data indicate that the enhanced expression of delta opioid receptor negatively modulates the analgesia induced by intracerebroventricular (i.c.v.) injection of hemokinin-1(4-11). PMID: 24587368
  15. findings show that, during prolonged heroin abstinence, delta opioid receptors regulate hedonic homeostasis, while mu opioid receptor signaling in serotonergic pathways and kappa opioid receptors together control social behaviors PMID: 24874714
  16. The C320T polymorphism in the delta-opioid receptor gene can explain line-specific differences in ethanol preference. PMID: 23301597
  17. a role for differential modulation of opioid receptor signaling by post-endocytic processing of peptide agonists by ECE2. PMID: 24847082
  18. SSTR4 and delta-Opioid receptor (dOR) exist in a heteromeric complex and function in synergistic manner. PMID: 24416361
  19. data demonstrate a distinct modulatory role of the hippocampal network activity by mu and delta opioid receptors PMID: 24260157
  20. Our study suggests that MOR(mu opioid receptors) and DOR(delta opioid receptors are involved in the interactions between cocaine and both deltorphins analogs PMID: 23965295
  21. delta opioid receptor activation at the central terminals of myelinated mechanoreceptors depresses synaptic input to the spinal dorsal horn, via the inhibition of voltage-gated calcium channels PMID: 24583022
  22. delta Opioid receptors modulate learning and memory performance by regulating hippocampus/striatum balance. PMID: 23303070
  23. our results reveal evidence of a long-term, experience-dependent plasticity in delta opioid receptor expression on striatal modulatory interneurons critical for the cognitive control of action. PMID: 24107940
  24. an anti-analgesic role for the DOR/MOR heteromer in pain. PMID: 23554887
  25. In mouse mPFC activation of mu- and delta-opioid receptors enhances DA D1-like receptor signaling likely through converging regulatory inputs on betagamma-stimulated adenylyl cyclase isoforms. PMID: 23073238
  26. In mouse hippocampus, expression of functional delta opioid receptors is mostly associated with interneurons emphasizing a presynaptic modulatory effect on the pyramidal cell firing rate. PMID: 22252784
  27. This study demonistrated that delta receptors are localized in GABAergic neuronal populations in hippocampus. PMID: 22750239
  28. The present results show that delta-opioid receptors are involved in the modulation of nicotine rewarding effects. PMID: 22669166
  29. in contrast to spatial cues, internal or discrete morphine-predicting stimuli permit full expression of morphine CPP in Oprd1 (-/-) mice. Delta receptors, therefore, appear to play a crucial role in modulating spatial contextual cue-related responses PMID: 22526530
  30. findings reveal a novel role of DOR in the control of thermogenic markers and energy expenditure PMID: 22593549
  31. delta opioid receptor activation inhibits anoxia-induced Na+ influx through Na+ channels via protein kinase C-dependent mechanisms in the cortex. PMID: 22609332
  32. crystal structure of the mouse delta-OR, bound to the subtype-selective antagonist naltrindole PMID: 22596164
  33. between CBR and delta opioid receptor PMID: 22235275
  34. There is an interplay between benzodiazepine receptors and delta-opioid receptors in regulating the respiratory effects of elevated carbon dioxide, which might be related to carbon dioxide induced panic. PMID: 21561601
  35. delta-opioid receptor-deficient mice show normal revaluation but are insensitive to the influence of outcome-related cues on choice behavior. PMID: 22302826
  36. The conditional knockout of delta-opioid receptor in primary afferent Na(V)1.8 neurons augmented mechanical allodynia in persistent pain models and abolished delta opioid analgesia in these models. PMID: 21295407
  37. Since DOR over-expression increases cortical tolerance to hypoxia, an increase in GABA receptors expression (an energy-costing process) may not be necessary in the cortex with DOR over-expression PMID: 21789893
  38. The delta receptor activity is not involved in morphine reinforcement but facilitates place conditioning in mice. PMID: 21168121
  39. The present study reveals a crucial role for Ser363 in the delta-opioid receptor in agonist-specific regulation of ERK activation patterns and functions. PMID: 21098639
  40. Delta receptors are required for full inhibitory coupling of mu-receptors to voltage-dependent Ca(2+) channels in dorsal root ganglion neurons. (DELTA RECEPTOR) PMID: 19357247
  41. results are consistent with the involvement of TM4 and/or TM5 at the DOR homodimer interface, but possibly with differing association propensities PMID: 21261298
  42. Data show that delta opioid receptor (DOPR)-mediated analgesia is not altered in preprotachykinin A knockout mice, and that substance P is not essential for membrane insertion and for the functional emergence of DOPR. PMID: 21044181
  43. The DOR-1 gene is required for the expression of the kappa2 opioid receptor subtype and it may be that a KOR-1/DOR-1 heterodimer mediates kappa2 pharmacology. PMID: 20036983
  44. Coexistence of delta-opioid receptors and mu-opioid receptors in small dorsal root ganglia neurons is a basis for direct interaction of opioid receptors in modulation of nociceptive afferent transmission and opioid analgesia. PMID: 20615975
  45. We show that the subtypes of the delta receptor, delta(1) and delta(2), have opposing effects on ethanol consumpti PMID: 19576572
  46. Antisense oligodeoxynucleotides to mRNA block the enhanced effects of opioids during intestinal inflammation PMID: 11779029
  47. DOR-1 expression is regulated by ikaros-2 and upstream stimulatory factor in mouse T lymphocytes PMID: 12431989
  48. Morphine dependence is examined in DOR-1 knockout mice. PMID: 12486185
  49. the carboxyl tail domain of mu and delta opioid receptors is not the sole determinant in directing the intracellular trafficking PMID: 12851402
  50. the mouse delta-opioid receptor is transcriptionally regulated by CpG methylation PMID: 12890683

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Brain, with high concentrations in the basal ganglia and limbic regions.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1