Recombinant Mouse Fatty acid desaturase 2 (Fads2)

Code CSB-CF007960MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Fads2; Fadsd2; Acyl-CoA 6-desaturase; Delta(6 fatty acid desaturase; D6D; Delta(6 desaturase; Delta-6 desaturase; Fatty acid desaturase 2
Species
Mus musculus (Mouse)
Expression Region
1-444
Target Protein Sequence
MGKGGNQGEGSTERQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVI GHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTA EDMNLFKTNHLFFFLLLSHIIVMESLAWFILSYFGTGWIPTLVTAFVLATSQAQAGWLQH DYGHLSVYKKSIWNHVVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFV LGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMISRRDWVDLAWAI SYYMRFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHLVMEIDLDHYRDWFSSQL AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALIDIVSSLKKSGELWLDAYLHK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors, acting as a fatty acyl-coenzyme A (CoA) desaturase that introduces a cis double bond at carbon 6 of the fatty acyl chain. Catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. Subsequently, in the biosynthetic pathway of HUFA n-3 series, it desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is then converted to docosahexaenoate (DHA)(22:6n-3), an important lipid for nervous system function. It can also desaturate (11E)-octadecenoate (trans-vaccenoate) at carbon 6 generating (6Z,11E)-octadecadienoate. In addition to Delta-6 activity, this enzyme exhibits Delta-8 activity with slight biases toward n-3 fatty acyl-CoA substrates.
Gene References into Functions
  1. Data (including data from studies using knockout mice) suggest that increased dietary intake of EPA (eicosapentaenoic acid) and DHA (docosahexaenoic acid) differentially affects activity of D5D/Fads1 and D6D/Fads2 in specific tissues. PMID: 28697636
  2. In comparison, Fads2-/- and WT mice fed AD showed minimal differences in n-6 PUFA content in serum and WAT, despite having significantly more AA than CD-fed mice. No differences in gene expression for common inflammatory adipokines (e.g. Mcp-1, Ccl5, Tnfalpha) or key regulators of eicosanoid production (e.g. Cox-2, Alox-12, Alox-15) were detected in WAT between any of the diet and genotype groups PMID: 29031400
  3. In this study, an obvious hepatic lipid accumulation was observed in essential fatty acid deficiency (EFAD) mice treated with a FADS2 inhibitor. FADS2 inhibition in the EFAD state reduced secretion of very low-density lipoprotein (VLDL) and markedly diminished Mead acid in phosphatidylcholine (PC) in the liver and plasma. PMID: 29353041
  4. Data (including data from studies using knockout mice) suggest that immunomodulatory effects of dietary omega-6 vs. omega-3 fatty acids are due, in part, to interconversion of the various unsaturated fatty acids consumed/administered; thus, delta-6 desaturase plays role in immunomodulatory effects of dietary unsaturated fatty acids. PMID: 27142734
  5. Using a sample of 534 twins, study observed a trend in the moderation of brain fatty acid effects on IQ by FADS2 variation. Using of publicly available gene expression databases from both humans and mice, showed that FADS2 variants also correlate with FADS1 brain expression PMID: 23826354
  6. differential PUFA profiles between HET mice and human FADS SNPs suggest low expression of both FADS1 and 2 genes in human minor haplotypes. PMID: 27613800
  7. FADS2 deficient mice are obesity resistant. PMID: 24378641
  8. knockdown of Elovl5, Fads1, or Fads2 decreased the level of Mead acid. PMID: 24184513
  9. D6D activity is upregulated during melanoma and lung tumor growth and that suppressing D6D activity, either by RNAi knockdown or a specific D6D inhibitor, dramatically reduces tumor growth. PMID: 23112819
  10. Results suggest that Fads2 is essential for spermatogenesis; Fads2-/- knockout mice develop docosahexaenoic acid deficiency and acrosome biogenesis is halted after release of proacrosomal granules. PMID: 21653892
  11. analysis of macrophage cholesterol biosynthesis and decreased cellular paraoxonase 2 (PON2) expression in Delta6-desaturase knockout (6-DS KO) mice PMID: 20042190
  12. We created D6D-null mice (-/-), which enabled us to study highly unsaturated fatty acid deficiency without depleting their precursors. PMID: 19351970
  13. methylation silencing of liver Fads2 expression and changes in liver fatty acids may contribute to the pathology of hyperhomocysteinemia. PMID: 17971455
  14. Conjugated linoleic acid-induced fat loss was found to be dependent on delta6-desaturase activity. PMID: 18719641
  15. deletion of delta6-fatty acid desaturase (FADS2) gene expression abolishes the initial step in the enzymatic cascade of PUFA synthesis PMID: 19172737

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Fatty acid desaturase type 1 family
Tissue Specificity
Highly expressed in the adrenal gland, liver, brain, and testis, tissues where lipogenesis and steroidogenesis are active. Also detected in lung, heart, and skeletal muscle.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1