Recombinant Mouse Formyl peptide receptor 2 (Fpr2)

In Stock
Code CSB-CF008855MO
Abbreviation Recombinant Mouse Fpr2 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Formylpeptide receptor-related sequence 2;Lipoxin A4 receptor-like protein;N-formylpeptide receptor-like 2
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-351aa
Target Protein Sequence
MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVTTIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIALDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNFGSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPLRVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGSYKILDMFVNPTSSLAYFNSCLNPMLYVFMGQDFRERFIHSLPYSLERALSEDSGQTSDSSTSSTSPPADIELKAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
High affinity receptor for N-formyl-methionyl peptides (FMLP), which are powerful neutrophil chemotactic factors. Stimulates chemotaxis in immune cells to site of infection or tissue damage upon recognition of several ligands, such as FMLP, or ligand involved in cell damage, disease or inflammation. Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation.
Gene References into Functions
  1. virus infection with enterovirus 71 and H1N1 PR8 influenza virus results in increased FPR2 expression. Inhibition of STAT3 phosphorylation in virus-infected cells repressed the induction of FPR2, which led to a reduction in viral loads. PMID: 29127186
  2. this study shows that formyl peptide receptor activation inhibits the expansion of effector T cells and synovial fibroblasts and attenuates joint injury in models of rheumatoid arthritis PMID: 29879657
  3. The influx of leukocytes into the peritoneum of WT and mFpr2(-/-) mice was analyzed. We demonstrate that mFpr2 is specifically activated by phenol-soluble modulin (PSM) peptides, and they represent the first secreted pathogen-derived ligands for the mFpr2. PMID: 28855276
  4. Study showed significantly increased expression of FPR1 and FPR2, during differentiation of neural stem cells (NSCs). The activation of FPRs promotes NSCs to differentiate into neurons with more primary neurites and branch points and longer neurites per cell. Meanwhile, this activation also inhibits the differentiation of NSCs into astrocytes. PMID: 28303030
  5. activation of Fpr2 in bone marrow after WKYMVm treatment provides cardiac protection through mobilization of circulating angiogenic cells after myocardial infarction. PMID: 27790799
  6. we suggest that Fpr2-mediated signaling in follicular dendritic cells plays a key role in germinal center maintenance in Peyer's patches PMID: 27974458
  7. FAM3D plays a role in gastrointestinal homeostasis and inflammation through its receptors FPR1 and FPR2. PMID: 26966188
  8. antagonist pretreatment or gene silencing of the RvD1 receptor, ALX/FPR2, abrogated the anti-inflammatory and pro-resolving actions of RvD1. These data indicate that RvD1 ameliorates IR-induced liver injury, and this protection is associated with enhancement of M2 polarization and efferocytosis via ALX/FPR2 activation PMID: 27317426
  9. a novel FPR2 agonist, the proteolytically stable alpha-peptide/beta-peptoid hybrid Lau-((S)-Aoc)-(Lys-betaNphe)6-NH2 (F2M2), showing comparable potency in activating human and mouse neutrophils by inducing a rise in intracellular Ca(2+) concentration and assembly of the superoxide-generating NADPH oxidase. PMID: 27422818
  10. We conclude that ANX-A1 is an important regulator of mast cell reactivity to compound 48/80 exerting a negative feedback effect through a mechanism that depends at least partly on the FPR receptor PMID: 26803520
  11. annexin A1- formyl peptide receptor 2 pathway mediated the insulin resistance of skeletal muscle, as well as systemic insulin sensitivity. PMID: 25616869
  12. Deficiency of formyl peptide receptor 2 is associated with increased inflammation and enhanced liver injury after LPS-stimulation PMID: 24956481
  13. AnxA1 and Fpr2 have a critical role in the manifestation of adrenal insufficiency in this LPS-induced model, through regulation of cholesterol ester storage PMID: 25818588
  14. Ldlr(-/-)xFpr2(-/-) mice exhibited delayed atherosclerosis development and less macrophage infiltration compared with Ldlr(-/-)xFpr2(+/+) mice. PMID: 25341894
  15. Compared with wild-type mice, Fpr2/3(-/-) animals exhibited exacerbation of disease severity, including hypothermia and cardiac dysfunction. PMID: 25512512
  16. Fpr1/2 are critical for normal healing of the sterile skin wound by mediating the first wave of neutrophil infiltration. PMID: 24603667
  17. FPR1 and FPR2 play an important role in the innate immune responses against Streptococcus pneumoniae within the central nervous system and the lack of the receptors leads to a dysregulation of the inflammatory response compared with wild-type mice. PMID: 24863484
  18. Oxidized low-density lipoprotein stimulates macrophages, resulting in chemotactic migration, TNF-alpha production, and foam cell formation via FPR2 signaling. PMID: 24361884
  19. During ischemia, neutrophil Fpr2/3 controls platelet/neutrophil aggregates with the rapid generation of circulating LXA4, which in turn modulates downstream vascular inflammatory responses evident during the reperfusion phase. PMID: 23733341
  20. FPR2 is not activated by lipoxin (LX)A; the molecular mechanism by which LXA functions still needs to be identified. PMID: 23643932
  21. Fpr2 mediated foam cell formation PMID: 23500463
  22. FPR2 is critical in mediating homeostasis, inflammation, and epithelial repair processes in the colon. PMID: 23454745
  23. Results indicate that the AnxA1/FPR2 system has an important role in effecting the resolution of cerebral inflammation in sepsis and may provide a novel therapeutic target. PMID: 22964301
  24. The mechanism involved impaired early neutrophil recruitment to the liver with Fpr2 being sole receptor for neutrophils to sense Listeria chemoattractant signals and for production of bactericidal superoxide. PMID: 23139859
  25. These results suggest that Fpr2 plays an important role in host defense against implanted LLC by sustaining macrophages in an M1 phenotype with more potent antitumor activities. PMID: 23139214
  26. results suggest that microvascular endothelial cells express mFPR2 which can be upregulated by proinflammatory factors IL-1beta and LPS through JNK and NF-kappaB related signaling pathways PMID: 21761148
  27. The conclusions drawn from these experiments are that neither compound 43 nor LXA4 works as FPR2 agonists in neutrophils, findings of importance for a proper interpretation of results obtained with these compounds as regulators of inflammation. PMID: 21535079
  28. The recognition of Abeta by the formylpeptide chemotactic receptor 2 seems to be a starting point of the signaling cascade inducing an inflammatory state in AD. PMID: 20456016
  29. Studies show that inflammation was more marked in Fpr2(-/-) mice. PMID: 20107188
  30. This study reveals a critical role for mFPR2 in the progression of allergic airway inflammation and immune responses. PMID: 20200280
  31. By selectively up-regulating FPR2 in microglia, TNF alpha has the capacity to amplify host response in inflammatory diseases in the central nervous system. PMID: 12270697
  32. TLR9 may play an important role in promoting microglial recognition of Abeta42 by up-regulating the expression of the G-protein- coupled receptor mFPR2 PMID: 16219804
  33. mouse neutrophils, which like macrophages and dendritic cells express Fpr2, responded to human and mouse F2L in both calcium flux and chemotaxis assays PMID: 17237393
  34. the effect of IFN-g and its synergy with CD40L on mFPR2 expression in microglia was mediated in part by TNF-alpha; IFN-g and CD40L may profoundly affect microglial cell responses in the pathogenic process in which mFPR2 agonist peptides are elevated PMID: 17237425
  35. IL-10 may affect the pathogenic process of Alzheimer's disease by up-regulating mFPR2 and thus favoring the recognition and internalization of Abeta(42) by activated microglial cells PMID: 17544285
  36. TLR2 and NOD2 cooperate to up-regulate the expression of mFPR2 and therefore, may actively participate in the pathogenic processes of brain inflammation and neurodegenerative diseases. PMID: 18299458
  37. (Poly(I:C)), which is a specific TLR3 ligand, and Imiquimod (R837), which is a specific TLR7 ligand, when used alone, each increased MAPK-dependent functional mFPR2 expression in microglial cells. PMID: 19559490

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Primarily expressed in neutrophils. Not detected in vomeronasal neurons.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*