Product Details

Target Names

Gpr183

Uniprot No.

Alternative Names

Gpr183; Ebi2; G-protein coupled receptor 183; Epstein-Barr virus-induced G-protein coupled receptor 2 homolog; EBI2; EBV-induced G-protein coupled receptor 2 homolog

Species

Mus musculus (Mouse)

Expression Region

1-357

Target Protein Sequence

MANNFTTPLATSHGNNCDLYAHHSTARVLMPLHYSLVFIIGLVGNLLALVVIVQNRKKIN STTLYSMNLVISDILFTTALPTRIAYYALGFDWRIGDALCRVTALVFYINTYAGVNFMTC LSIDRFFAVVHPLRYNKIKRIEYAKGVCLSVWILVFAQTLPLLLTPMSKEEGDKTTCMEY PNFEGTASLPWILLGACLLGYVLPITVILLCYSQICCKLFRTAKQNPLTEKSGVNKKALN TIILIIVVFILCFTPYHVAIIQHMIKMLCSPGALECGARHSFQISLHFTVCLMNFNCCMD PFIYFFACKGYKRKVMKMLKRQVSVSISSAVRSAPEENSREMTESQMMIHSKASNGR

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

G-protein coupled receptor expressed in lymphocytes that acts as a chemotactic receptor for B-cells, T-cells, splenic dendritic cells, monocytes/macrophages and astrocytes. Receptor for oxysterol 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC) and other related oxysterols. Mediates cell positioning and movement of a number of cells by binding the 7-alpha,25-OHC ligand that forms a chemotactic gradient. Binding of 7-alpha,25-OHC mediates the correct localization of B-cells during humoral immune responses. Collaborates with CXCR5 to mediate B-cell migration; probably by forming a heterodimer with CXCR5 that affects the interaction between of CXCL13 and CXCR5. Guides B-cell movement along the B-cell zone-T-cell zone boundary and later to interfollicular and outer follicular regions. Its specific expression during B-cell maturation helps position B-cells appropriately for mounting T-dependent antibody responses. Also acts as a chemotactic receptor for some T-cells upon binding to 7-alpha,25-OHC ligand. Promotes follicular helper T (Tfh) cells differentiation by positioning activated T-cells at the follicle-T-zone interface, promoting contact of newly activated CD4 T-cells with activated dendritic cells and exposing them to Tfh-cell-promoting inducible costimulator (ICOS) ligand. Expression in splenic dendritic cells is required for their homeostasis, localization and ability to induce B- and T-cell responses: GPR183 acts as a chemotactic receptor in dendritic cells that mediates the accumulation of CD4(+) dendritic cells in bridging channels. Regulates migration of astrocytes and is involved in communication between astrocytes and macrophages. Promotes osteoclast precursor migration to bone surfaces. Signals constitutively through G(i)-alpha, but not G(s)-alpha or G(q)-alpha. Signals constitutively also via MAPK1/3 (ERK1/2).

Gene References into Functions

This study support the hypothesis that EBI2/oxysterol signalling not only controls immune cell function, but may also adjust how astrocytes sense and respond to inflammatory stimuli PMID: 29374507
GPR183 promotes lymphoid organ development and indicate that oxysterol-GPR183-dependent positioning within tissues controls group 3 innate lymphoid cells activity and intestinal homeostasis PMID: 29343433
These results, for the first time, display a role for EBI2 in myelin development and protection from demyelination under pathophysiological conditions PMID: 29246262
the data indicates that molecules in the EBI2 signalling pathway are sensitive to pro-inflammatory signals, and that EBI2 plays a role in communication between astrocytes and macrophages. PMID: 27166278
EBI2 expressing cells are abundant within multiple sclerosis (MS) white matter lesions. PMID: 28147280
These data identify a role for EBI2 in promoting efficient thymic central tolerance. PMID: 28741728
mice lacking EBI2 in T cells or CD25 in dendritic cells have reduced T follicular helper cells and mount defective T-cell-dependent plasma cell and germinal centre responses PMID: 27147029
findings establish an essential role for EBI2 in CD4(+) DC positioning and homeostasis and in facilitating capture and presentation of blood-borne particulate antigens PMID: 23682316
EBI2 is a negative regulator of type I interferons in plasmacytoid and myeloid dendritic cells. PMID: 24386204
Regulated expression of EBI2 on DC populations is therefore critical for the generation and correct positioning of splenic DCs and the initiation of immune responses. PMID: 23502855
Regulation of B cell migration by EBI2 has an important role in controlling the positioning of activated B cells within lymphoid follicles in the early phases of B cell responses during cell differentiation and affinity maturation. PMID: 21948984
These findings establish a role for EBI2 in helping control B cell position at multiple stages during the Ab response PMID: 21844396
ligand targeting EBI2. In turn, this molecule provides a useful tool for further characterization of EBI2 as well as serving as a potent lead compound. PMID: 21673108
important role for EBI2 in promoting B cell localization in the outer follicle, and show that differential expression of this receptor helps position B cells appropriately for mounting T-dependent antibody responses PMID: 19597478
EBI2 provides a previously uncharacterized dimension to B cell migration that is crucial for coordinating rapid versus long-term antibody responses. PMID: 19615922

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed in mature B-cells and increases in expression early after activation, before being down-regulated in germinal center B-cells. Expressed in astrocytes. Specifically expressed in CD4(+) dendritic cells but not in CD8(+) dendritic cells. Expressed

Database Links

KEGG: mmu:321019

UniGene: Mm.265618

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF661031MO
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse G-protein coupled receptor 183 (Gpr183)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage