Recombinant Mouse Gastrin-releasing peptide receptor (Grpr)

Code CSB-CF009943MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Grpr; Gastrin-releasing peptide receptor; GRP-R; GRP-preferring bombesin receptor
Species
Mus musculus (Mouse)
Expression Region
1-384
Target Protein Sequence
MAPNNCSHLNLDVDPFLSCNDTFNQSLSPPKMDNWFHPGFIYVIPAVYGLIIVIGLIGNI TLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFI QLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFS DLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLAIISVYYYFIARNLIQ SAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSML HFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLMNRSHSTGRSTTCMT SFKSTNPSATFSLINRNICHEGYV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for gastrin-releasing peptide (GRP). Signals via association with G proteins that activate a phosphatidylinositol-calcium second messenger system, resulting in Akt phosphorylation. Contributes to the regulation of food intake. Contributes to the perception of prurient stimuli and transmission of itch signals in the spinal cord that promote scratching behavior, but does not play a role in the perception of pain. Contributes primarily to nonhistaminergic itch sensation. Contributes to long-term fear memory, but not normal spatial memory.
Gene References into Functions
  1. These data suggest that GRPR expression in fibroblast-like synoviocytes (FLS)and that exogenous GRP are able to activate FLS invasion. This effect occurs at least in part through the AKT activation. Therefore, understanding of the GRP/GRPR pathway could be relevant in the development of FLS-targeted therapy for Rheumatoid arthritis . PMID: 28733141
  2. ablating GRP receptor-expressing neurons eliminated basal and hypoxia-induced sighing, but left breathing otherwise intact initially PMID: 26855425
  3. Together, we define the respective function of NMBR and GRPR in itch transmission, and reveal an unexpected relationship not only between the two receptors but also between the two populations of interneurons in itch signaling. PMID: 25209280
  4. BNP-NPRA signaling is involved in both itch and pain and does not function upstream of the GRP-GRPR dedicated neuronal pathway. PMID: 24438367
  5. The present results suggest that BB2 receptor-expressing spinal neurons transmit herpes-associated itch by BB2 receptor-independent signaling. PMID: 23778077
  6. spinal GRPr and NMBr independently drive itch neurotransmission in mice. PMID: 23826298
  7. GRPR and stathmin control in opposite directions both cued fear extinction and neural activities of the amygdala and prefrontal cortex PMID: 22312434
  8. Gastrin-releasing peptide receptor mediates chemotaxis in neutrophils, and may be an alternative chemotactic receptor playing a role in the pathogenesis of inflammatory disorders. PMID: 22203955
  9. The data suggest that opioid-induced itch is an active process concomitant with but independent of opioid analgesia, occurring via the unidirectional cross-activation of GRPR signaling by MOR1D heterodimerization PMID: 22000021
  10. We propose that deletion of GRPR leads to the induction of depression-like behavior which is paralleled by dysregulation of amygdala gene expression, potentially resulting from deficient light-induced corticosterone release in GRPR-knockout mice PMID: 21254899
  11. GRP-R-deficient mice showed no significant different in risk assessment behavior of conventional anxiwety parameters, so GRP-R may not impact this anxiety or emotional behavior. PMID: 11803457
  12. GRP/GRP-R play a transient and non-critical role in intestinal development PMID: 11960700
  13. GRPR has a role in regulation of fear and memory for fear in the mouse amygdala PMID: 12526815
  14. GRPR gene expression was detected predominantly in utero in lung development PMID: 12959933
  15. MCH was significantly enhanced in BRS-3-deficient mice but not in GRP-R-deficient mice PMID: 14988239
  16. GRP-R immunoreactivity was observed in the lateral (LA), central, and basolateral amygdaloid (BLA) nuclei and NTS, which are important regions for memory performance. PMID: 15680955
  17. Changes in GRPr are light driven and not endogenously organized. Diurnal variation in GRPr activity probably underlies intra-SCN signaling important for entrainment and phase shifting. PMID: 16519669
  18. GRPR may represent the first molecule that is dedicated to mediating the itch sensation in the dorsal horn of the spinal cord PMID: 17653196
  19. New evidence for the occurrence of marked effects of bombesin/gastrin-releasing peptide concerning both the articular chondrocytes and the inflammatory process is obtained in this study PMID: 17911468
  20. These findings demonstrate that GRP and GRP-R have important oncogenic properties beyond their established mitogenic functions. PMID: 18753628

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in pancreas and brain. Detected in suprachaismatic nucleus neurons. Detected in neurons in the dorsal horn of the spinal cord. Detected in inhibitory GABAergic interneurons in the lateral nucleus of the amygdala.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1