Recombinant Mouse Hereditary hemochromatosis protein homolog (Hfe)-VLPs

Code CSB-MP010323MO
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Hfe
Uniprot No.
Research Area
Metabolism
Alternative Names
Hfe; Mr2; Hereditary hemochromatosis protein homolog
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
25-359aa
Target Protein Sequence
QALPPRSHSLRYLFMGASEPDLGLPLFEARGYVDDQLFVSYNHESRRAEPRAPWILEQTSSQLWLHLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLGVVSESHILQVVLGCEVHEDNSTSGFWRYGYDGQDHLEFCPKTLNWSAAEPGAWATKVEWDEHKIRAKQNRDYLEKDCPEQLKRLLELGRGVLGQQVPTLVKVTRHWASTGTSLRCQALDFFPQNITMRWLKDNQPLDAKDVNPEKVLPNGDETYQGWLTLAVAPGDETRFTCQVEHPGLDQPLTASWEPLQSQAMIIGIISGVTVCAIFLVGILFLILRKRKASGGTMGGYVLTDCE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.
Gene References into Functions
  1. H67D mutation in HFE gene is associated with decreased susceptibility to manganese accumulation in the brain and neurotoxicity induced by inhaled manganese. PMID: 27295312
  2. the aging HFE KO mouse on an SV129 genetic background has the potential to facilitate the investigation of cardiomyopathy induced by HFE gene mutations. PMID: 28558946
  3. unlike homozygous Hfe deletion, heterozygous gene deletion disrupted glucose homeostasis but did not affect lipid metabolism or liver injury. PMID: 27354540
  4. Single Hjv(-)/(-) and double Hfe(-)/(-)Hjv(-)/(-) mice exhibit comparable iron overload. Hfe and Hjv regulate hepcidin via the same pathway. PMID: 25609138
  5. Results show that HFE requires HJV to activate downstream signal transduction pathways for hepcidin regulation. PMID: 25608116
  6. Alterations in cholesterol metabolism associated with expression of H63D-HFE may contribute to the development of AD. PMID: 24439478
  7. These results support in vivo studies which suggest that Hfe and Tfr2 can independently regulate hepcidin. PMID: 24155934
  8. A mutation in the HFE gene is associated with altered brain iron profiles and increased oxidative stress in mice. PMID: 23429074
  9. Hfe-knockout mice did not have higher brain iron levels than wildtype controls. PMID: 22466002
  10. Hfe(-/-) retinal pigment epithelial cells exhibited slower senescence rate and higher survivin expression than wild type cells. Hfe(-/-) cells migrated faster and showed greater glucose uptake and increased expression of GLUTs. PMID: 23169885
  11. Findings suggest a novel role for Hfe and/or imbalanced iron homeostasis in the regulation of the inflammatory response in the lung and hereditary hemochromatosis. PMID: 22745741
  12. Double mutant mice lacking functional Hfe or Tfr2 and Tmprss6 exhibited a severe iron deficiency microcytic anemia phenotype mimicking the phenotype of single mutant mice lacking functional Tmprss6 demonstrating that Hfe and Tfr2 are not substrates for Tmprss6. PMID: 22244935
  13. Disruption of both Hfe and Tfr2 caused more severe hepatic iron overload with more advanced lipid peroxidation, inflammation, and portal fibrosis than was observed with the disruption of either gene alone. PMID: 22383097
  14. the Hfe(-/-) mouse brain showed numerous significant changes in transcript levels although few of these related to proteins directly involved in iron homeostasis PMID: 22370144
  15. Loss of central and peripheral CD8+ T-cell tolerance to HFE in mouse models of human familial hemochromatosis. PMID: 22531912
  16. Hfe(-/-) mice show defective hepatic-intestinal iron and lipid signaling, which predispose them toward diet-induced hepatic lipotoxicity, accompanied by an accelerated progression of injury to fibrosis. PMID: 21817060
  17. the HFE H63D mutant protein is associated with prolonged ER stress and chronically increased neuronal vulnerability. PMID: 21349849
  18. neither genetic loss of Hfe nor hepatic Hfe overexpression modulated the hepcidin elevation and systemic iron deficiency of Tmprss6(-/-) mice PMID: 21355094
  19. Hfe influences erythropoiesis by 2 distinct mechanisms: limiting hepcidin expression under conditions of simultaneous iron overload and stress erythropoiesis, and impairing transferrin-bound iron uptake by erythroid cells. PMID: 21059897
  20. transferrin receptor 2 and HFE are involved in holotransferrin-dependent signaling for the regulation of furin which involved Erk phosphorylation. Furin in turn may control hepcidin expression. PMID: 20634490
  21. Hepcidin expression does not rescue the iron-poor phenotype of Kupffer cells in Hfe-null mice after liver transplantation. PMID: 20338170
  22. Hfe is limiting in formation of the Hfe/Tfr2 complex that regulates hepcidin expression PMID: 20177050
  23. Multiple pregnancies do not reduce body iron stores in Hfe-/- mice. PMID: 20110460
  24. In Hfe knockout mice Hamp1 mPNA was decreased and duodenal ferroportin mRNA expression was increased compared to wild-type animals. PMID: 19426170
  25. Prolyl-peptidyl isomerase, Pin1, phosphorylation is compromised in association with the expression of the HFE polymorphic allele, H63D. PMID: 20060900
  26. Hfe deficiency causes a previously unrecognized increase in gene expression of hepatic acute phase proteins and duodenal digestive enzymes PMID: 19787063
  27. Iron uptake from plasma transferrin by the duodenum is impaired in the Hfe knockout mouse. PMID: 11943867
  28. Mouse hemachromatosis protein (Hfe) plays a minor role in down-regulation but does not influence the up-regulation of iron absorption PMID: 12149232
  29. evidence that HFE regulates a functional cross-talk between crypt and villi enterocytes PMID: 12367579
  30. In normal & Hfe knock-out mice, duodenal nonheme iron content correlated with liver iron stores. This did not depend on dietary iron levels. However, duodenal iron content was reduced in Hfe knock-out mice for any given content of liver iron stores. PMID: 12468424
  31. Mice lacking Hfe or producing a C282Y mutant Hfe protein develop hyperferremia and have high hepatic iron levels. PMID: 12704388
  32. Oxidative damage in colon and mammary tissue in null-mutant mice PMID: 12706501
  33. Results show no correlation between the expression levels of the duodenal iron transporters DMT1 and IREG1 and the liver iron content in Hfe (hemochromatosis) knockout mice. PMID: 14618243
  34. In mice, deficiency of Hfe is associated with the same pattern of iron overload observed in patients with hereditary hemochromatosis. PMID: 14656876
  35. Rag1 deficiency in Hfe knock-out mice leads to heightened iron overload, mainly in the liver. PMID: 14656877
  36. H67D mutation leads to partial loss of Hfe function and can contribute to murine hereditary hemochromatosis. PMID: 14673107
  37. Hfe deficient mice react normally to endotoxin and their hepatocytes react normally to IL-6. PMID: 15192150
  38. Treatment of C57BL/6 Hfe(-/-) mice with 15% ethanol for 6.5 months did not increase hepatic uroporphyrin PMID: 15382179
  39. over-expression of mHFE, but not of hHFE, in a mouse transformed cell line, results in a most significant inhibition of transferrin-uptake which correlated with apoptotic cell death PMID: 15389541
  40. These results are the first in a series of studies to understand how mutations in Hfe can be a risk factor for AD. PMID: 15718038
  41. Reconstitution of Hfe-deficient mice with wt bone marrow resulted in augmented capacity of the spleen to store iron and in significantly decreased liver iron loading, accompanied by a significant increase of hepatic hepcidin mRNA levels. PMID: 15914561
  42. direct recognition of mouse Hfe molecules by cytotoxic T lymphocytes (CTLs) was demonstrated in DBA/2 Hfe knockout mice PMID: 16123136
  43. In conclusion, these results suggest that although Hfe is necessary for the establishment of hepcidin basal levels. PMID: 16565419
  44. HFE and TFR2 interact in cells; this interaction is not abrogated by disease-associated mutations of HFE and TFR2; and that TFR2 competes with TFR1 for binding to HFE PMID: 16893896
  45. The specific localization of HFE and its interacting proteins, TfR1 and TfR2, at the basolateral membrane of RPE is relevant to the regulation of iron homeostasis in this cell. PMID: 17003411
  46. An inverse correlation between transferrin saturation and transferrin half-life for both HFE-deficient and wild-type mice, which suggests that HFE does not have a direct effect on transferrin catabolism PMID: 17116709
  47. in an alcohol-susceptible strain, mutation of the Hfe gene diminished the response of the measured iron indices to alcohol treatment PMID: 17207112
  48. Rgmc regulation by LPS is Hfe-independent. PMID: 17255318
  49. Hfe is required for appropriate expression of the "iron hormone" hepcidin which then controls intestinal iron absorption. PMID: 17264297
  50. Hfe(-/-) mice demonstrate increased adiponectin levels and activation of AMP-dependent kinase PMID: 17971451

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
MHC class I family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*