Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1(Klrg1)

Code CSB-CF012472MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O88713
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MADSSIYSTLELPEAPQVQDESRWKLKAVLHRPHLSRFAMVALGLLTVILMSLLMYQRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
Source in vitro E.coli expression system
Gene Names Klrg1
Protein Names Recommended name: Killer cell lectin-like receptor subfamily G member 1 Alternative name(s): Mast cell function-associated antigen 2F1
Expression Region 1-188
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.
Subcellular Location Cell membrane, Single-pass type II membrane protein
Tissue Specificity Expressed specifically on natural killer (NK) cells and activated CD8 T-cells. Not detected in spleen, thymus, lymph node, testis, brain or kidney. Not detected on mast cell lines, bone marrow-derived mast cells, or peritoneal mast cells.
Database Links

KEGG: mmu:50928

STRING: 10090.ENSMUSP00000032207

UniGene: Mm.20434

Related Products

Klrg1 Proteins

Klrg1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.