Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1 (Klrg1), partial

In Stock
Code CSB-EP012472MO1
Abbreviation Recombinant Mouse Klrg1 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
(Mast cell function-associated antigen 2F1)
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
57-188aa
Target Protein Sequence
QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.
Gene References into Functions
  1. Treg cell accumulation in intestinal tumours from APC(min/+) mice was exclusively due to the increase in KLRG1(+) GATA3(+) Treg cells. PMID: 28437001
  2. Although absence of KLRG1 is not enough to increase intestinal Treg cells in KLRG1 knockout mice, KLRG1 ligation reduces T-cell receptor signals and the competitive fitness of individual Treg cells in the intestine. PMID: 28437578
  3. This finding provides a rationale for the reciprocal expression of KLRG1 and CD103 in different CD8(+) T-cell subsets. PMID: 26014037
  4. Cytotoxic KLRG1-expressed CD8 effector cells and defective T regulatory cells cause murine autoimmune cholangitis. PMID: 24556277
  5. KLRG1(+) iNKT cells coexpressing CD49d and granzyme A persisted for several months and displayed a potent secondary response to cognate antigen. PMID: 25118276
  6. Data indicate that CD103(+)CD8(+) T(RM) cells developed in the skin from epithelium-infiltrating precursor cells that lacked expression of the effector-cell marker KLRG1. PMID: 24162776
  7. Data indicate that increments of CD8 + effector memory T cells in human and mouse chronic lymphocytic leukemia (CLL)(Emu-TCL1 model) were due to an expansion of the inhibitory killer cell lectin-like receptor G1 (KLRG1) expressing cellular subset. PMID: 24022692
  8. Despite their differences, KLRG1+ and KLRG1- Treg cells proved similarly potent in suppressing experimental autoimmune encephalomyelitis. PMID: 23436224
  9. KLRG1(-/-) mice had a significant survival extension after Mycobacterium tuberculosis infection compared to wild-type controls, and maintained a significantly lower level of pulmonary bacterial load throughout chronic infection. PMID: 23340310
  10. CD8+ T cells lacking Id2 do not generate a robust terminally differentiated killer cell lectin-like receptor G1 (KLRG1hi) effector population, but display a cell-surface phenotype and cytokine profile consistent with memory precursors. PMID: 23325888
  11. The lower inhibitory capacity of mKLRG1 compared with hKLRG1 can thus be rationalized by a decreased proportion of dimeric entities, which can be pinpointed to a single amino acid. PMID: 22684915
  12. KLRG1high-expressiong CD8 T cells isolated from the lung during the peak of influenza infection could long survive in vitro and participate in a recall response to influenza virus infection upon adoptive transfer. PMID: 23089397
  13. The KLRG1+NKG2A+ positive phenotype correlates with protective efficacy for generating effector and proliferative memory responses from a pool of CD8 T cells during persistent gamma-herpesvirus 68 infection. PMID: 21346231
  14. Interleukin-2-activated natural killer cells interact with tumor necrosis factor-alpha-stimulated endothelial cells to induce their proliferation and promote angiogenesis through a mechanism involving alpha4beta7 integrin and KLRG1. PMID: 20971926
  15. KLRG1 does not play a deterministic role in the generation & functional characteristics of NK & T-cell subsets. The inhibitory potential of KLRG1 in mice is weak. Strong activation signals during viral infections may override the inhibitory signal. PMID: 20201037
  16. Both pathogenic and nonpathogenic in vivo activation of NK cells induces cell surface expression of KLRG1, while in vitro studies show that engagement of the receptor on a transfected NK cell line inhibits cytokine production and cell-mediated cytoxicity. PMID: 11884419
  17. Expression of KLRG1 on CD8+ and CD4+ T cell subsets isolated from naive animals appears to be largely restricted to T cells that exhibit a memory phenotype. PMID: 12794113
  18. MafA is differentially expressed in beta-cells where it regulates insulin gene expression. PMID: 14765989
  19. repetitive and persistent antigen stimulation leads to an increase in KLRG1 expression of virus-specific CD8+ T cells PMID: 16140789
  20. KLRG1 ligation by E-, N-, or R-cadherins may regulate the cytotoxicity of killer cells to prevent damage to tissues expressing cadherins. PMID: 16461340
  21. Upon phosphorylation of the immunoreceptor tyrosine-based inhibitory motif tyrosine, KLRG1 recruits both SHIP-1 and SHP-2 but not SHP-1. PMID: 17307799
  22. NK cells acquire KLRG1 on their surface during development, and this expression correlates with functional distinctions from other peripheral NK cells in vivo. PMID: 17404256
  23. IL-12 signaling drives CD8+ T cell IFN-gamma production and differentiation of KLRG1+ effector subpopulations during Toxoplasma gondii Infection. PMID: 18424713
  24. KLRG1 formed multimeric protein complexes in T cells in addition to the previously described mono- and dimeric molecules PMID: 19009530
  25. KLRG1 recognizes the N-terminal homodimeric interface of domain 1 of E-cadherin and binds only the monomeric form of E-cadherin to inhibit the immune response. PMID: 19654330
  26. our results provide novel insights on how KLRG1 and E-cadherin interactions are integrated to differentially regulate not only KLRG1(+) cells, but also E-cadherin-expressing cells, such as dendritic cells. PMID: 19855082

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed specifically on natural killer (NK) cells and activated CD8 T-cells. Not detected in spleen, thymus, lymph node, testis, brain or kidney. Not detected on mast cell lines, bone marrow-derived mast cells, or peritoneal mast cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*