Recombinant Mouse Lysine-specific demethylase 6A (Kdm6a), partial

In Stock
Code CSB-EP025774MO
Abbreviation Recombinant Mouse Kdm6a protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Histone demethylase UTX;Ubiquitously transcribed TPR protein on the X chromosome;Ubiquitously transcribed X chromosome tetratricopeptide repeat protein;[histone H3]-trimethyl-L-lysine
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1095-1258aa
Target Protein Sequence
KWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.7 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. Plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitant with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A. Plays a demethylase-independent role in chromatin remodeling to regulate T-box family member-dependent gene expression.
Gene References into Functions
  1. Lymphomas with low UTX expression express high levels of Efnb1, and cause significantly poor survival. PMID: 30006524
  2. Kdm6a expression improved the development of cloned mouse embryos by reducing H3K27me3 and increasing rDNA transcription. PMID: 29239295
  3. study provides a systematic screening of TSGs in vivo and identifies UTX as an important epigenetic regulator in lung tumorigenesis. PMID: 29632194
  4. UTX molecular function is in establishing appropriate chromatin structure to regulate crucial neural crest stem-cell signaling pathways. PMID: 29073101
  5. When JMJD3 levels were decreased by RNA interference, the embryo development rate and quality were improved, but the knockdown of UTX produced the opposite results. PMID: 27384759
  6. results reveal a previously unknown role of kdm6a in promoting innate IFN-beta gene transcription at enhancer, in addition to demethylation at promoter PMID: 28284523
  7. Long-term exposure to atmospheric particulates, PM2.5 up-regulated H3K4 and H3K9 methylation in IL-6 and IFN-beta promoter regions through down-regulating Kdm6a expression. The results suggest that short-term exposure to PM2.5 significantly enhances the survival rate of influenza A-contaminated mice, while long-term PM2.5 inhalation lowers the capacity of pulmonary macrophages to secrete IL-6 and IFN-beta. PMID: 28887033
  8. UTX-MLL4-p300 transcriptional regulatory network establishing an "active enhancer landscape" and defines a detailed mechanism for the joint deposition of H3K4me1 and H3K27ac. PMID: 28732206
  9. These results suggest that the demethylase activity of Jmjd3, but not that of Utx, affects mouse axial patterning in concert with alterations in Hox gene expression. PMID: 28188179
  10. Utx governs adipogenesis by regulating c-Myc in a differentiation stage-specific manner PMID: 28319137
  11. Ectopic expression of KDM6A antagonized TGF-beta-induced epithelial-mesenchymal transition and cell migration of lung cancer cells through its demethylase activity. PMID: 28698146
  12. this study reveals how UTX regulates the development of invariant natural killer T cells through multiple epigenetic mechanisms PMID: 27992400
  13. The results define UTX as a bivalency-resolving histone modifier necessary for stem cell differentiation PMID: 26762983
  14. Study demonstrated that the mammary luminal lineage relies on KDM6A to ensure a transcription program leading to differentiated alveoli. Failure to fully implement this program results in structurally and functionally impaired mammary tissue. PMID: 27215382
  15. differentiating embryonic stem cells (ESCs) depend on KDM6 and the H3K27me3 demethylase activity is crucially involved in DNA damage response and survival of differentiating ESCs. PMID: 26759175
  16. a critical role for the enzymatic activity of UTX in activating muscle-specific gene expression during myofiber regeneration and have revealed a physiological role for active H3K27 demethylation in vivo. PMID: 26999603
  17. Results propose that Utx plays important roles in osteoblast differentiation by controlling the expressions of Runx2 and Osterix. PMID: 25920016
  18. Utx is required for T-cell development. PMID: 26328764
  19. Genome-wide association between Six4, MyoD, and the histone demethylase Utx during myogenesis. PMID: 26229056
  20. Mice with a T-cell-specific UTX deletion had fewer Tfh cells, reduced germinal center responses, no virus-specific IgG, inability to resolve chronic LCMV infections, and decreased expression of IL-6-receptor-alpha and other Tfh cell-related genes. PMID: 26431949
  21. UTX may play a potential role in regulation of brown adipocyte gene expression PMID: 26306033
  22. Utx and Jmjd3 mutant mouse embryonic fibroblasts (MEFs) demonstrate dramatic loss of H3K27me3 from promoters of several Hox genes and transcription factors. PMID: 25101834
  23. Inhibition of histone demethylases UTX and JMJD3 inhibits HSV-1 reactivation from sensory neurons. PMID: 25552720
  24. H3K27me3 demethylase UTX is a gender-specific tumor suppressor in T-cell acute lymphoblastic leukemia PMID: 25320243
  25. JMJD3 is essential for the initiation and maintenance of T-ALL, as it controls important oncogenic gene targets by modulating H3K27 methylation; by contrast, UTX functions as a tumour suppressor and is frequently genetically inactivated in T-ALL PMID: 25132549
  26. Utx is required for proper formation of ectoderm and mesoderm in vitro, and similar to its C.elegans homologue, has demethylase dependent and independent functions. PMID: 23573229
  27. Our study implicates Kdm6a, a gene that escapes X inactivation, in the regulation of genes important in reproduction, suggesting that KDM6A may play a role in the etiology of developmental and reproduction-related effects of X chromosome anomalies. PMID: 23658530
  28. UTX regulates stem cell migration and hematopoiesis. PMID: 23365460
  29. Our data suggest that UTX and UTY are able to regulate gene activity through demethylase independent mechanisms. PMID: 23028370
  30. Utx-null embryos had reduced somite counts, neural tube closure defects and heart malformation that presented between E9.5 and E13.5. PMID: 22826230
  31. identification of Utx as a novel mediator with distinct functions during the re-establishment of pluripotency and germ cell development PMID: 22801502
  32. Jmjd3 and UTX, mediate a functional interaction between the lineage-defining T-box transcription factor family and a Brg1-containing SWI/SNF remodeling complex. PMID: 21095589
  33. These results indicate that Rb and Rbl2 are downstream target genes of Utx and may play important roles in Utx-mediated cell growth control. PMID: 20650264
  34. The study shows a two-step mechanism for UTX-mediated demethylation of histone H3-Lys27 trimethylation (H3K27me3) at muscle-specific genes during myogenesis. PMID: 20300060
  35. Females are found to have significantly higher expression levels of Utx than males in most brain regions except the amygdala. PMID: 18434530
  36. Utx are markedly upregulated during murine skin repair. PMID: 19575012
  37. The JmjC domain-containing protein UTX specifically demethylates mono-, di- and trimethylated K27 of histone H3 in vitro. PMID: 18003914
  38. UTX associates with MLL3- and MLL4-containing histone H3 K4 methyltransferase complex(es) that also include ASH2L, RBBP5, WDR5, hDPY-30, PTIP, PA1, NCOA6. PMID: 17500065

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
UTX family
Tissue Specificity
Expressed in brain, heart and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*