Recombinant Mouse Muscarinic acetylcholine receptor M2 (Chrm2)

Code CSB-CF887665MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Chrm2
Uniprot No.
Alternative Names
Chrm2; Chrm-2; Muscarinic acetylcholine receptor M2
Species
Mus musculus (Mouse)
Expression Region
1-466
Target Protein Sequence
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI VKPNNNNMPGGDGGLEHNKIQNGKAPRDGGTENCVQGEEKESSNDSTSVSAVASNMRDDE ITQDENTVSTSLGHSKDDNSRQTCIKIVTKTQKGDACTPTSTTVELVGSSGQNGDEKQNI VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is adenylate cyclase inhibition. Signaling promotes phospholipase C activity, leading to the release of inositol trisphosphate (IP3); this then triggers calcium ion release into the cytosol.
Gene References into Functions
  1. The three receptor sets considered (mAChR, AR and TrkB receptors) intervene in modulating the conditions of the competition between nerve endings. PMID: 27339059
  2. In the present study, the functional coupling of Gi/o protein-coupled receptors to GalR1, and the CB1 receptor subtype for endocannabinoids were analyzed in the 3xTg-AD mice model of Alzheimer's disease in the prodromal and advanced stages. In addition, the activity mediated by Gi/o protein-coupled M2/4 muscarinic receptor subtypes was also analyzed in brain areas involved in anxiety and cognition. PMID: 27223629
  3. We found that knockout of the M2/3 receptor significantly inhibited ST37 acupuncture-induced enhancement of gastric motility, jejunal motility, and colonic motility. PMID: 27978539
  4. Muscarinic M2 receptors in the circular muscular layer of mouse ileum exert a previously undocumented function in gut motility via the regulation of gap junctions PMID: 26475617
  5. IL-17 production in the hearts of M2AChR mice is dependent on P2x7 expression in dilated cardiomyopathy. PMID: 26592184
  6. Expression of the M2 receptors mediating cholinergic contractile stimuli of the detrusor muscle was dysregulated in both Mras-/- males and females, although only males exhibited a urinary phenotype. PMID: 26516777
  7. These results demonstrate that M2R are dysfunctional and do not affect ACh levels in PRiMA knockout mice, likely because of down-regulation and/or loss of receptor-effector coupling. PMID: 26506622
  8. Beta-2-Adrenergic and M2-muscarinic receptors decrease basal t-tubular L-type calcium channel activity and suppress ventricular contractility in heart failure. PMID: 24389135
  9. Data indicate taht m2R-RGS6-IKACh pathway sets heart rate variability independently from the autonomic input. PMID: 24204714
  10. the M3 receptor has a pro-inflammatory role in cigarette smoke-induced neutrophilia and cytokine release, yet M1 and M2 receptors have an anti-inflammatory role PMID: 23397297
  11. M2 receptors play an essential role in the generation of intestinal rhythmic motor activity, and M3 receptors have a modulatory role in controlling the periodicity of the rhythmic activity PMID: 23889852
  12. These results suggest for the first time a role of M2 in growth-related changes in extracellular matrix genes during myopia development in a mammalian model. PMID: 23649821
  13. M2-mediated contractions in the M3KO and WT strains were decreased by the Rho kinase (ROCK) inhibitor Y27632 as well as the ROCK, PKA and PKG inhibitor H89. PMID: 23786223
  14. M2 receptor is co-localized with VGLUT2 on intraganglionic laminar endings of esophagus. PMID: 23742744
  15. The m2 receptor is concentrated at cholinergic synapses located on the perikarya and most proximal dendrites, and enriched at glutamatergic synapses both in perikarya and dendrites. PMID: 23184757
  16. Presence of M2 mAChR is sufficient and necessary to mediate the carbachol-induced membrane hyperpolarization and inhibition of SpECTs in laterodorsal tegmental nucleus neurons. PMID: 22956788
  17. In muscararinic M2 receptor knockout mice, although the main cardioinhibitory receptors are not present in the heart, the function is not much affected PMID: 23093370
  18. This study demonstrated that cholinergic projections recruit M(2) receptors to redistribute the gain of LTP in CA3 pyramidal cells in an input-specific manner PMID: 22490561
  19. The function of M2 MR is substituted by beta3-AR and that these effects are mediated via adenylyl cyclase rather than NOS. PMID: 22222438
  20. The results suggested that myocarditis and dilated cardiomyopathy associated with the presence of autoantibodies aginst M2 muscarinic acetylcholine receptors are autoimmune diseases. PMID: 22328321
  21. enhanced tracheal contraction of the BK beta1 knockout can be ascribed to a defect in BK channel opposition of M2 receptor-mediated contractions PMID: 21300746
  22. Caveolae disruption decreased muscarine-induced bronchoconstriction in wild-type and abolished it in M2R(-/-) and M3R(-/-) mice. Thus M2R and M3R signaling pathways require intact caveolae. PMID: 20023174
  23. We therefore conclude that M1 and M4 receptors are the major mAChR subtypes responsible for direct cholinergic modulation of the excitatory hippocampal circuit. PMID: 21160001
  24. Lack of association of a spontaneous mutation of the Chrm2 gene with behavioral and physiologic phenotypic differences in inbred mice. PMID: 20819376
  25. determination of m2 and m3 muscarinic receptors in the central auditory system PMID: 20665816
  26. These findings indicate that cholinergic modulation through M2 receptors regulates feedforward inhibition in a context-dependent manner. PMID: 20386723
  27. Data suggest HL-1 cells express GIRK1/4 and M2 muscarinic receptors and are a good model to study acetylcholine-activated potassium currents. PMID: 20186548
  28. Striatal mAChRs, by inhibiting ACh release from cholinergic interneurons and thus modifying nAChR activity, offer variable control of DA release probability that promotes how DA release reflects activation of dopaminergic axons. PMID: 20203199
  29. During gating, the alpha-helix of the delta subunit M2 segment bends or swivels about its central amino acid residues, with the conformational change of the extracellular half preceding the movement of the intracellular half upon opening. PMID: 11969415
  30. Prefrontal cortex acetylcholine release, EEG slow waves, and spindles are modulated by M2 autoreceptors in C57BL/6J mouse. PMID: 12037184
  31. muscarinic analgesia is exclusively mediated by a combination of M(2) and M(4) mAChRs at both spinal and supraspinal sites. PMID: 12391271
  32. The role of M2 muscarinic receptor in smooth muscle contraction is analyzed in M2 knockout mice. PMID: 12486155
  33. Regional brain localization of FP-TZTP in M2 receptor knockout mice is significantly decreased compared to wild-type in amygdala, brain stem, caudate putamen, cerebellum, cortex, hippocampus, hypothalamus, superior colliculus, and thalamus. PMID: 12668051
  34. mAChRs of the M2 subtype mediate muscarinic agonist-induced bradycardia, tremor, hypothermia, and autoinhibition of release in several brain regions. Review. PMID: 12675128
  35. presynaptic M(2)-muscarinic receptors play a major role in the control of the time course of evoked acetylcholine release under physiological conditions. PMID: 12686574
  36. These data demonstrate a major role for M2 muscarinic receptor subtypes in mediating parasympathomimetic effects. PMID: 12713643
  37. Acute and chronic cholinergic stimulation provoke, in vivo, depletion of the membrane store of somatodendritic m2R through different intracellular mechanisms. PMID: 12794734
  38. M2 receptors play a key role in regulating pharmacologically & physiologically evoked hippocampal acetylcholine release required for the development and expression mnemonic & cognitive events. PMID: 12874603
  39. The muscarinic acetylcholine receptor M2 is a mediator of bradycardia and bronchoconstriction due to vagal innervation. PMID: 14977875
  40. M2 receptors are required for intact working memory, behavioral flexibility, and hippocampal synaptic plasticity. PMID: 15537882
  41. This study indicate that both M2 mediate the muscarinic autoinhibition in ACh release in the longitudinal muscle with myenteric plexus preparation of the mouse ileum. PMID: 15574798
  42. Because ACTH and corticosterone responses were greater in male and female M(2) knockout mice, the M(2) receptor appears to dampen the stress response PMID: 16280029
  43. Muscarinic M2 receptor (M2R)-mediated transactivation of EGFR specifically involves Fyn but not c-Src or Yes. PMID: 16337776
  44. Hearts of chronic chagasic mice had increased muscarinic receptor densities compared to normal controls. PMID: 16978452
  45. Substance P-mediated sustained contraction is negatively regulated by the M2 receptor at a presynaptic level in the ileum. PMID: 17008557
  46. This study provides new information that the M(2) mAChRs play a critical role in the control of glutamatergic input from primary afferents to dorsal horn neurons. PMID: 17050831
  47. affects cognition, as seen in knockout mice PMID: 17192665
  48. M2R was observed exclusively in the umbrella cells. PMID: 17337281
  49. Intestinal myocytes have 3 distinct muscarinic pathways mediating cationic channel activation. M2/M3 pathway targeting 70-pS channels serves as the major contributor to membrane potentials. PMID: 17463038
  50. M(2)-AChR may mediate an inhibitory regulation on matrix metalloproteinase function PMID: 18055517

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM2 sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1