Recombinant Mouse Oxytocin receptor (Oxtr)

Code CSB-CF017316MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Oxtr
Uniprot No.
Alternative Names
Oxtr; Oxytocin receptor; OT-R
Species
Mus musculus (Mouse)
Expression Region
1-388
Target Protein Sequence
MEGTPAANWSIELDLGSGVPPGAEGNLTAGPPRRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASVPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA AAEGSDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSARYLKGSRPGETS ISKKSNSSTFVLSRCSSSQRSCSQPSSA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Repression of OXTR signaling acutely modulates social interaction and sensory response profiles. PMID: 29231812
  2. Results show that OTR activation might constitute one of the neural substrate that is involved involved in the facilitative mechanisms to restore the sexual olfactory preferences of sexually naive Tph2-/- female mice. PMID: 29470551
  3. depressive-like behavior alters oxytocin receptor (OxtR) and arginine vasopressin receptor type 1a (AvpR1a) gene expression in the hippocampus (HC) of male mice. PMID: 27525673
  4. Chemogenetic activation of Oxtr(PBN) neurons robustly suppressed noncaloric fluid intake, but did not decrease food intake after fasting or salt intake PMID: 29184212
  5. Binding activity of OXTR in neonatal mice. PMID: 28235051
  6. Findings suggest that OXTR is an acute-phase protein and that its increased expression is regulated by NF-kappaB and functions to attenuate cellular inflammatory responses in macrophages. PMID: 28049625
  7. Results provide evidence that the oxytocin system contributes to the regulation of ethanol drinking and sensitivity and position OxtR as a central molecular mediator of ethanol's effects within the mesolimbic system, suggest that OxtR manipulation may be a relevant strategy to address ethanol use disorders. PMID: 27306084
  8. Data suggest that the study might contribute to the monosynaptic analysis of neuronal circuits and to the optogenetic analysis of neurons expressing oxytocin receptor (OXTR). PMID: 26442453
  9. Our results suggest that microglial abnormality is a potential mechanism of the development of Oxt/Oxtr mediated ASD-like phenotypes. PMID: 26926566
  10. The results suggest that oxytocin receptor is required for conditioned effects of an ethanol-associated social stimulus PMID: 26282397
  11. This study identify highly specialized roles of lateral septal mGluR5 and Oxtr in the the regulation of discrete social behaviors, and suggest that deficits in social interactions. PMID: 25824423
  12. OTR-null residents exhibited greater aggression toward intruders of the same strain compared to OTR wild-type or heterozygous residents PMID: 24929102
  13. Raphe serotonin neuron-specific oxytocin receptor knockout reduces aggression without affecting anxiety-like behavior PMID: 25677455
  14. Oxtr signaling is crucial for entrainment of odor to social cues but is dispensable for entrainment to nonsocial cues. Oxytocin conveys saliency of social stimuli to sensory representations in the piriform cortex during odor-driven social learning. PMID: 26139372
  15. Study used the oxytocin analog Carbetocin and nucleus accumbens viral-mediated overexpression to assess the role of OxtR in the acquisition, extinction, and reinstatement of ethanol-induced conditioned place preference PMID: 25449413
  16. Oxytocin's effect on osteoblast differentiation is mediated by and dependent on the internalization of Oxtrs and their translocation to the nucleus, facilitated by successive interactions with beta-arrestins, Rab5, Kpnb1), and Tnpo1. PMID: 25378700
  17. Silencing of interneurons that express the oxytocin receptor in the medial prefrontal cortex (mPFC) of female mice resulted in loss of social interest in male mice specifically during the sexually receptive phase of the estrous cycle. PMID: 25303526
  18. Impairments in the initiation of maternal behavior in oxytocin receptor knockout mice PMID: 24892749
  19. Oxytocin elicits satiety through both central and peripheral oxytocin receptors. PMID: 24877632
  20. Collectively, our results suggest that brain region-specific expression of the mouse Oxtr gene is epigenetically regulated by DNA methylation of its promoter. PMID: 24275011
  21. Early interactions with mother and peers independently build adult social skills and shape BDNF and oxytocin receptor brain levels PMID: 22910688
  22. This study is the first to demonstrate that the central oxytocin/oxytocin receptor system plays important roles in the regulation of body temperature homeostasis. PMID: 24002032
  23. This study demonistrated that Fear-enhancing effects of septal oxytocin receptors. PMID: 23872596
  24. The Oxtr(+/-) mouse is a unique animal model for investigating how partial loss of the Oxtr gene impair social interactions. PMID: 22967062
  25. LPS increased COX-2, connexin 43, and oxytocin receptor expression in uterus. PMID: 22676250
  26. It was shown that male aggression is heightened in oxytocin receptor -/- mice, and that differential activation in the medial amygdala, and possibly the lateral septum, may be contributing to the heightened aggression. PMID: 22609339
  27. the profile for Oxtr KO mice, including consistent social deficits, and reduced levels of communication, models multiple components of the autism spectrum disorders phenotype PMID: 22100185
  28. We consider the processes by which experience can affect oxytocin receptor binding, and what is known about the directionality of experience effects on oxytocin receptors--REVIEW PMID: 22245313
  29. we do find evidence for the role of OTR in predicting maternal behavior in mice PMID: 22300676
  30. Mice that have Oxt receptor loss restricted to the forebrain that begins postweaning have a reduction in freezing behavior during acquisition, as well as during context and cue retention. PMID: 21668734
  31. Results suggest that variations of estrogen alpha/beta receptor levels are associated with differences in social interaction through the OT and AVP systems, by upregulating gene expression for those peptides and the oxytocin and vasopressin 1a receptors. PMID: 21749489
  32. investigation of regulation of ghrelin secretion in the MGN3-1 cell line: evidence that oxytocin and oxytocin receptors are involved PMID: 21521750
  33. beta-arrestin is a multifunctional scaffold protein that mediates both desensitization of the OXTR, leading to decreases in uterine contractility PMID: 21139074
  34. Inflammatory cytokines modulate the expression of functional oxytocin receptors in airway smooth muscle. PMID: 20670427
  35. results show that in mast cells ovarian hormones modulate OTR but not serotonin transporter(SERT) expression; oxytocin action on 5HT uptake depends on OTRs expressed; signaling between OTR and the SERT is mediated through activation of protein kinase C. PMID: 12374464
  36. Increases in myometrial oxytocin receptor and estrogen receptor alpha expression in late pregnant relaxin+/+ mice were attenuated in relaxin-/- mice. Probably mediated via activation of estrogen receptor-alpha. PMID: 12959965
  37. the present study has identified novel sites of oxytocin receptor expression in the mouse brain, suggesting additional functions of the oxytocinergic system PMID: 14596857
  38. These results suggest that oxytocin (OT)-induced uterine contraction is not regulated solely by the quantity of OT receptors in the non-pregnant mouse uterus. PMID: 15358162
  39. Myometrial OTRs were significantly decreased on gestation day 18.5 in relaxin (Rlx)-/- mice than in Rlx+/+ mice PMID: 15956692
  40. OXTR plays a critical role in regulating several aspects of social behavior, including aggression in males and maternal nurturing in females PMID: 16249339
  41. Oxytocin receptor-deficient mice developed late-onset obesity in mice. PMID: 18520999
  42. An investigation of various behaviours, most notably social recognition, in both oxytocin receptor containing and oxytoxin receptor knockout mice. PMID: 18655873
  43. ORE deficient mice display several aberrations in social behaviours, including male aggression, and mother-offspring interaction. PMID: 18655874
  44. Oxytocin may regulate serotonin release and exert anxiolytic effects via direct activation of oxytocin receptor expressed in serotonergic neurons of the raphe nuclei. PMID: 19228979
  45. We hypothesize that the Oxtr is involved in 'fine' intrastrain recognition, but is less important in 'broad' interstrain recognition. PMID: 19531157

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X