Recombinant Mouse Pituitary adenylate cyclase-activating polypeptide type I receptor (Adcyap1r1)

Code CSB-CF001347MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Adcyap1r1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1
Species
Mus musculus (Mouse)
Expression Region
21-496
Target Protein Sequence
MHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEV FRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYE PESGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIIILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTITLRLA RSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIK RKWRSWKVNRYFTMDFKHRHPSLASSGVNGGTQLSILSKSSSQLRMSSLPADNLAT
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract.
Gene References into Functions
  1. PACAP/PAC1 signaling is important for light regulated behavior, VIP/VPAC2 signaling for stable clock function and both signaling pathways may play a role in shaping diurnality versus nocturnality. PMID: 29155851
  2. Its signaling evokes long-lasting nociceptive behaviors through the activation of spinal astrocytes. PMID: 26948958
  3. The results suggested that sympathetic nerve innervation may be responsible for Pituitary adenylate cyclase-activating polypeptide-regulated hematopoiesis in bone marrow, mainly via PAC1. PMID: 26925806
  4. spinal astrocytic activation triggered by the PAC1 receptor stimulation contributes to both induction and maintenance of the long-term mechanical allodynia. PMID: 27175011
  5. PACAP/PAC1 signaling has a role in light regulated food anticipatory activity PMID: 26757053
  6. PAC1 plays a prominent role in chronic restraint stress response, but less so in the acute restraint stress response. PMID: 25853791
  7. overexpression of Pac1 rescued the Zac1 knockdown neuronal migration phenotype PMID: 26424889
  8. PAC1 has ligand-independent and dimer-dependent intrinsic/basal activity, conferring cells with anti-apoptotic activities against serum withdrawal, which is involved in the Wnt/beta-catenin signal and is associated with the endocytosis of PAC1 dimers. PMID: 25426938
  9. PACAP and PAC1-R expression increased in cumulus cells isolated at different times after treatment with human chorionic gonadotropin. PMID: 23684890
  10. These results suggest that Sp1 cross-linking might be crucial in negative regulation of PAC1 gene expression due to TG2 in OGD-induced ER stress. PMID: 24045949
  11. This study demonistrated that pac1r expression in reactive astrocytes induced by global brain ischemia in mice. PMID: 23564104
  12. PAC1R mRNA expression in the hippocampus was significantly elevated on day 7 after ischemia induced by bilateral common carotid artery occlusion. . PMID: 22669509
  13. PAC1R transcript expression exhibited differential responses in NGF-OE mice that were tissue (urothelium vs. detrusor) cyclophosphamide-induced-cystitis duration-dependent. PMID: 22700375
  14. We conclude that PACAP/PAC1R signaling is involved in the sustained phase of the pupillary light reflex at high irradiances. PMID: 22459045
  15. current results show that the action of GnRH in the regulation of gonadotropin subunit expression is enhanced by the presence of PAC1Rs PMID: 21658369
  16. Increased PAC1R mRNA expression in lung tissue was present under inflammatory conditions PMID: 21059121
  17. Results indicate that the expression of PAC1 is clearly important for maintaining the homeostasis of gastric acid secretion. PMID: 20821075
  18. Data describe PACAP, vasoactive intestinal polypeptide, and PAC1, VPAC1, VPAC2 transcripts or protein expression in urothelium and detrusor smooth muscle and lumbosacral dorsal root ganglia in NGF-overexpressing and wildtype mice. PMID: 20449688
  19. data suggest that perturbations in the PACAP-PAC1 pathway are involved in abnormal stress responses underlying post-traumatic stress disorder PMID: 21350482
  20. PACAP may therefore function through PAC1 receptors to protect neurons from cell death during inflammatory cytokine release PMID: 20654718
  21. data from LbetaT2 cell line suggest that PAC1-R and PACAP are produced locally within the gonadotrophs following GnRH stimulation; possible role in gene expression regulation of gonadotropin alpha subunits PMID: 20553777
  22. The data of this study demonstrated that an appropriate level of PACAP signaling is required for normal retinogenesis and visual function. This finding may have implications in GABAergic neuron-related neurological conditions. PMID: 19596361
  23. PAC1 variants expressed in mouse pancreatic islets seem to be coupled to adenylate cyclase but not to PLC. PMID: 11897681
  24. PAC1 receptor is solely responsible for the PACAP-induced [Ca2+]i signalling and secretion of vasopressin and oxytocin in the somatodendritic region of supraoptic neurones PMID: 12899682
  25. At threshold LTP of PACAP+/- mice was impaired greater than the one of PAC1R-/- mice. Thus, both PACAP and PAC1R could contribute to the establishment of LTP in a gene dosage-dependent manner. PMID: 14600504
  26. In vivo PAC1-mediated signaling seems to play a pivotal role for the transcriptional regulation of brain derived neurotrophic factor, as demonstrated in PAC1 mutants with alterations in hippocampal expression of BDNF and its receptor TrkB. PMID: 15082190
  27. PAC1 signaling is an important factor in the development and/or functioning of neural pathways associated with pheromone processing and the regulation of social interactions in mice. PMID: 15470144
  28. The absence of PAC1 causes pulmonary hypertension and right heart failure after birth. These in vivo findings demonstrate the crucial importance of PAC1-mediated signaling for the maintenance of normal pulmonary vascular tone during early postnatal life. PMID: 15520307
  29. PAC1 receptor is involved in neutrophil recruitment in different target organs, in adhesion molecules expression, and in coagulation-related molecule fibrinogen synthesis. PMID: 15661828
  30. PAC1 receptor signaling in the suprachiasmatic nucleus in response to light stimulation induces a down-regulation of CaM expression and that CaM is involved in the photic-entrainment mechanism PMID: 15800378
  31. fibrinogen expression through PAC1 receptor, providing an advantage to design more specific drugs complementing standard intensive care therapy in septic shock PMID: 16888200
  32. PAC1(3a) was originally discovered in testes as another potential regulator in rat astrocytes PMID: 16888214
  33. assessed the binding affinity and ability to stimulate adenylyl cyclase of the PCA1 variant-expressing cells for pituitary adenylate cyclase-activating polypeptide PMID: 16888230
  34. These results suggest that the PACAP/PAC1 system may play a dual role in neural/glial progenitor cells not only differentiation but also proliferation in the cortical astrocyte lineage via Ca2+-dependent signaling pathways through PAC1. PMID: 17115416
  35. the combination of alternative splicing events in the EC1 domain and the IC3 loop create a variety of PAC1 isoforms, which in turn may contribute to the functional pleiotropism of PACAP. PMID: 17442841
  36. PACAP may participate in the neurodevelopment with the stage-specific expression of PAC1R and that PACAP plays important roles in neurons as well as in glial cells PMID: 17900711
  37. All of the activity-dependent neuroprotective protein-immunopositive cells co-localized with PAC1R immunoreactivity PMID: 17942168
  38. Results suggest that endogenous PACAP plays an important role in cell survival during cerebellar development, through the activation of the PAC1 receptor. PMID: 18409023
  39. Results suggest that PAC1-R may play a gating role in passage permitting through perception of geomagnetic orientation and fear signals, but not perception of visual orientation, and it regulates behavioral performance in retrieval of memory in mice. PMID: 18781286
  40. Mice lacking the PACAP type I receptor have impaired photic entrainment and negative masking. PMID: 18922961
  41. beta-Arrestin 1 is required for PAC1 receptor-mediated potentiation of long-lasting ERK1/2 activation by glucose in pancreatic beta-cells. PMID: 19074139

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1