Recombinant Mouse Potassium channel subfamily K member 9 (Kcnk9)

Code CSB-CF663392MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Kcnk9
Uniprot No.
Alternative Names
Kcnk9; Task3; Potassium channel subfamily K member 9; Acid-sensitive potassium channel protein TASK-3; TWIK-related acid-sensitive K(+ channel 3
Species
Mus musculus (Mouse)
Expression Region
1-402
Target Protein Sequence
MKRQNVRTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLKAEEVRLRGKYNISSDDYQ QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCLGAAAFSQ CEDWSFFHAYYYCFITLTTIGFGDFVALQAKGALQRKPFYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNTDEELLEGEVAEILAGNPRRVSVRAPQRRKRHHAMYFLRKYGRTLCYLCF PGTNWGKDDDDDDDDDVVDNVVVTAPISAPAPAPAPAPAPAAVAAGATIRSVRATVHTVS CRVEEIPPDVLRNTYFRSVFGAIPPGMHTCGDHRLHLRRKSI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
pH-dependent, voltage-insensitive, background potassium channel protein.
Gene References into Functions
  1. impairment of the leak K(+) channel (Kcnk9) decreased sleep duration. Based on these results, we hypothesize that leak K(+) channels regulate sleep duration in mammals. PMID: 30224462
  2. Acute hypercapnia (5% CO2) stimulated ventilation in TASK-1/3(-/-) and wild-type mice to a similar extent; however, at higher CO2 concentrations the stimulation of ventilation was more pronounced in TASK-1/3(-/-) mice. At hyperoxia (100% O2), TASK-1(-/-), TASK-3(-/-) and wild-type mice showed the physiological small decrease of ventilation. TASK-1/3(-/-) mice exhibited an abnormal increase of ventilation under hyperoxia. PMID: 28673876
  3. results demonstrate that neurotensin (NT) transiently increased the neuronal excitability of dentate gyrus granule cells (GCs) by inhibiting TASK-3 channels; NT-mediated increases in neuronal excitability facilitate long-term potentiation at the perforant path-GC synapses PMID: 25405940
  4. KCNK9 channels are not involved in hearing. PMID: 26549439
  5. THe results of this study suggested that dysfunction of KCNK9 causes a migration defect in the cortex via an activity-dependent mechanism. PMID: 23236211
  6. Oxygen and mitochondrial inhibitors modulate both monomeric and heteromeric TASK-1 and TASK-3 channels in mouse carotid body type-1 cells. PMID: 24042502
  7. Data indicate that in 1-day-old Task3-/- mice, renal renin concentration was lower than in wild-type mice. PMID: 23698720
  8. DPP6 co-expression with TASK-3 results in the formation of a protein complex that enhances resting membrane potassium conductance. PMID: 23593319
  9. An extracellular ion pathway plays a central role in the cooperative gating of a K(2P) K+ channel by extracellular pH PMID: 23319597
  10. Task3 plays an important role in the adaptation of aldosterone secretion to dietary salt intake. PMID: 22878402
  11. This study demonistrated that kcnk9 gene expression in mouse dorsal raphe nucleus PMID: 22534482
  12. TASK3 channel genes may contribute to the development of low renin essential hypertension and idiopathic hyperaldosteronism in mice. PMID: 22493079
  13. TASK channels are not required for the stimulation of aldosterone production by protons but their inhibition by physiological acidosis may contribute to full expression of the steroidogenic response. PMID: 21111026
  14. Kcnk9 gene is imprinted, with preferential expression from the maternal allele in mouse brain. PMID: 17704508
  15. inhibition by glucose in neurons is mediated by ion channels not previously implicated in central or peripheral glucose sensing: tandem-pore K(+) (K(2P)) channels PMID: 16731510
  16. TASK3 and HCN2 channels stabilize the membrane potential by a mutual functional interactions. PMID: 16760342
  17. TASK-like conductances are more prevalent in inhibitory interneurons than previously supposed. PMID: 16837582
  18. Our results support a novel role for TASK genes in enhancing neuronal excitability and promoting high-frequency firing, but suggest that TASK1/3 subunits are not essential for orexin cell responses to glucose and pH. PMID: 19508695
  19. TASK-3 knockout mice exhibit a slower progression from their waking to sleeping states and their sleep episodes as well as their REM theta oscillations are more fragmented. PMID: 19805135

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1