Recombinant Mouse Proteinase-activated receptor 2 (F2rl1)

Code CSB-CF007925MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
F2rl1; Gpcr11; Gpr11; Par2; Proteinase-activated receptor 2; PAR-2; Coagulation factor II receptor-like 1; G-protein coupled receptor 11; Thrombin receptor-like 1
Species
Mus musculus (Mouse)
Expression Region
39-399
Target Protein Sequence
SLIGRLETQPPITGKGVPVEPGFSIDEFSASILTGKLTTVFLPVVYIIVFVIGLPSNGMA LWIFLFRTKKKHPAVIYMANLALADLLSVIWFPLKISYHLHGNNWVYGEALCKVLIGFFY GNMYCSILFMTCLSVQRYWVIVNPMGHPRKKANIAVGVSLAIWLLIFLVTIPLYVMKQTI YIPALNITTCHDVLPEEVLVGDMFNYFLSLAIGVFLFPALLTASAYVLMIKTLRSSAMDE HSEKKRQRAIRLIITVLAMYFICFAPSNLLLVVHYFLIKTQRQSHVYALYLVALCLSTLN SCIDPFVYYFVSKDFRDHARNALLCRSVRTVNRMQISLSSNKFSRKSGSYSSSSTSVKTS Y
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for trypsin and trypsin-like enzymes coupled to G proteins. Its function is mediated through the activation of several signaling pathways including phospholipase C (PLC), intracellular calcium, mitogen-activated protein kinase (MAPK), I-kappaB kinase/NF-kappaB and Rho. Can also be transactivated by cleaved F2r/Par1. Involved in modulation of inflammatory responses and regulation of innate and adaptive immunity, and acts as a sensor for proteolytic enzymes generated during infection. Generally is promoting inflammation. Can signal synergistically with Tlr4 and probably Tlr2 in inflammatory responses and modulates Tlr3 signaling. Has a protective role in establishing the endothelial barrier; the activity involves coagulation factor X. Regulates endothelial cell barrier integrity during neutrophil extravasation, probably following proteolytic cleavage by PRTN3. Proposed to have a bronchoprotective role in airway epithelium, but also shown to compromise the airway epithelial barrier by interrupting E-cadherin adhesion. Involved in the regulation of vascular tone; activation results in hypotension presumably mediated by vasodilation. Associates with a subset of G proteins alpha subunits such as GNAQ, GNA11, GNA14, GNA12 and GNA13, but probably not with G(o) alpha, G(i) subunit alpha-1 and G(i) subunit alpha-2. Believed to be a class B receptor which internalizes as a complex with arrestin and traffic with it to endosomal vesicles, presumably as desensitized receptor, for extended periods of time. Mediates inhibition of TNF-alpha stimulated JNK phosphorylation via coupling to GNAQ and GNA11; the function involves dissociation of Ripk1 and Tradd from Tnfr1. Mediates phosphorylation of nuclear factor NF-kappa-B RELA subunit at 'Ser-536'; the function involves Ikbkb and is predominantly independent of G proteins. Involved in cellular migration. Involved in cytoskeletal rearrangement and chemotaxis through beta-arrestin-promoted scaffolds; the function is independent of GNAQ and GNA11 and involves promotion of cofilin dephosphorylation and actin filament severing. Induces redistribution of Cops5 from the plasma membrane to the cytosol and activation of the JNK cascade is mediated by Cops5. Involved in the recruitment of leukocytes to the sites of inflammation and is the major PAR receptor capable of modulating eosinophil function such as proinflammatory cytokine secretion, superoxide production and degranulation. During inflammation promotes dendritic cell maturation, trafficking to the lymph nodes and subsequent T-cell activation. Involved in antimicrobial response of innate immune cells; activation enhances phagocytosis of Gram-positive and killing of Gram-negative bacteria. Acts synergistically with interferon-gamma in enhancing antiviral responses.
Gene References into Functions
  1. PAR-2 is expressed basolaterally in airway cells, where it stimulates both intracellular Ca(2+) release and Ca(2+) influx, which activates low-level nitric oxide production, increases apical membrane Cl(-) permeability approximately 3-5-fold, and increases ciliary beating approximately 20-50%. PMID: 28874459
  2. PAR2 activation in the prostate may contribute to the development of lower urinary tract dysfunction through proinflammatory as well as profibrotic pathways. PMID: 26860791
  3. Our data show that PAR2 counterbalanced enhanced contractions to ET-1 in aortas from Tsk mice. PAR2 could represent a possible target for novel drugs in the treatment of vascular complications in fibrosis. PMID: 27625162
  4. thrombin is increased in a mouse model of cancer cachexia in a partially interleukin-6 dependent manner PMID: 28058802
  5. Data show that activated protein C signals via protease activated receptors PAR2/PAR3 to expand Treg cells, mitigating the disease in mice. PMID: 28827518
  6. PAR2 plays an important and previously unrecognised anti-apoptotic role in T cell development PMID: 28951199
  7. thrombin has a role in diet-induced obesity through fibrin-driven inflammation PMID: 28737512
  8. PAR2 modulation was sufficient to induce islet cell transdifferentiation in the absence of beta-cells. PMID: 27809303
  9. Our results are suggestive that PAR2 inhibition may play a role in the treatment of diseases with increased inflammatory responses in renal systems PMID: 28694352
  10. PAR2/GSK3beta is a novel pathway that plays a critical role in the regulation of stem/progenitor cell survival and proliferation in normal colon crypts and colon cancer. PMID: 27313176
  11. PAR2 is critically important in the pathogenesis of adenine-induced tubular injury PMID: 28025140
  12. The levels of miR-223, miR-339 and miR-21, which are associated with platelet activation, were elevated in pooled mouse plasma exosomes before thrombosis and enriched in thrombin-stimulated platelet-derived exosomes in vitro. PMID: 27198239
  13. Neutrophil elastase induced acute inflammation and pain in knee joints of mice. These changes are PAR2-dependent and appear to involve activation of a p44/42 MAPK pathway. Blocking neutrophil elastase, PAR2 and p44/42 MAPK activity can reduce inflammation and pain, suggesting their utility as therapeutic targets. PMID: 26140667
  14. Reductions in astrogliosis, inflammation and neuromotor recovery observed in protease Activated Receptor 2 knockout mice after spinal cord injury suggests that this receptor and its agonists represent new drug targets to foster neuromotor recovery. PMID: 26316358
  15. Stimulation of PAR-2 activates Nf-kappaB signaling, resulting in RelA nuclear translocation and enhanced expression of pro-inflammatory mRNAs in oral squamous cell carcinoma. PMID: 26839311
  16. Tryptase and protease-activated receptor-2 stimulate scratching behavior in a murine model of ovalbumin-induced atopic-like dermatitis PMID: 26049029
  17. This study reveals, for the first time, an important role for PAR2 in allergic lung inflammation PMID: 24048772
  18. HAI-1 may have a critical role in maintaining normal keratinocyte morphology through regulation of PAR-2-dependent p38 mitogen-activated protein kinase signaling. PMID: 25842366
  19. PAR2 activation through endogenous mast cell tryptase activity could be required, at least partially, to mediate CCL11-induced eosinophil migration PMID: 24972241
  20. These studies identify the thrombin receptor as a powerful extracellular regulatory switch that could be readily targeted to improve myelin production in the face of white matter injury and disease. PMID: 25628003
  21. PAR2 knockout prevented bone cancer-related pain behaviours and associated neurochemical changes in dorsal root ganglion and dorsal horn. PMID: 23893658
  22. TR deficiency inhibits osteoclastogenesis by decreasing RANKL/OPG ratio, resulting in a high bone mass phenotype PMID: 25460576
  23. These findings indicate that hematopoietic TF-PAR2 signaling plays a pivotal role in the hepatic inflammatory responses, steatosis, and hepatic insulin resistance that lead to systemic insulin resistance and type 2 diabetes in obesity. PMID: 25476527
  24. findings unveil an important mechanism by which IL-1beta regulates its own endothelial cytotoxic actions by augmenting neuronal Par2 expression to repress sequentially IL-1 receptor type I and Sema3A expression. PMID: 25478809
  25. Data suggest that proteinase-activated receptor 2 activation leads to up-regulation of the dual oxidase-2/reactive oxygen species pathway in airway epithelial cells (AECs). PMID: 25684443
  26. Data show that proteinase-activated receptor (PAR)-2-dependent inflammatory signaling as an essential component of matriptase-mediated and potentiation of ras-mediated oncogenesis. PMID: 24469043
  27. Serine proteases and protease-activated receptor 2 mediate the proinflammatory and algesic actions of diverse stimulants PMID: 24749982
  28. Deletion of PAR-2 results in a significant decrease in medial meniscus destabilization-induced cartilage damage. Chondroprotection appears to occur through modulation of extracartilaginous events. PMID: 25200274
  29. PAR2 was required for the development of chronic pelvic pain in experimental autoimmune prostatitis. PMID: 24726923
  30. The role of PAR-2 activation in allergic sensitization and house dust mite-induced allergic airway inflammation, was investigated. PMID: 24651123
  31. Mutant versions of F2rl1 that prevent nuclear relocalization but not plasma membrane activation interfere with Vegfa but not Ang1 expression. Complementary factors are therefore regulated by the subcellular localization of F2rl1 that governs angiogenesis. PMID: 25216639
  32. PAR-2 signaling contributes to the pathogenesis of hypertrophy and heart failure PMID: 24312345
  33. It triggers pancreatic nociception. PMID: 24162021
  34. The present study demonstrates that Klk6 signals through PAR1 to regulate oligodendrocyte process stability and extension, myelin gene expression, and cell survival in the presence of oligotoxic agents. PMID: 23832758
  35. PAR2 synergizes with the TGFbeta signaling pathway to contribute to renal injury and fibrosis. PMID: 24253040
  36. PAR2 signaling is required for hyperexcitability of colonic nociceptive DRG neurons induced by colonic supernatant of diarrhea-predominant irriable bowel syndrome patients. PMID: 23958521
  37. Data suggest a tissue factor (TF) and protease-activated receptor 2 (PAR-2)-dependent mechanism on dexamethasone-dendritic cells (DC) in vitro and unprimed DC in vivo that contributes to the low immunogenicity of these cells. PMID: 23347132
  38. Cross-talk between PAR2 and TLR4 contributes to vascular homeostasis PMID: 22957757
  39. Renal proteinase-activated receptor 2 has a role in the control of blood pressure and plasma potassium level PMID: 23430254
  40. mast cell/chymase-mediated intestinal epithelial barrier function is mediated by proteinase-activated receptor 2/matrix metallopeptidase 2-dependent PMID: 23306080
  41. Protease-activated receptor 2 (PAR2) protein and transient receptor potential vanilloid 4 (TRPV4) protein coupling is required for sustained inflammatory signaling PMID: 23288842
  42. Mast cell degranulation with subsequent release of tryptase and protease-activated receptor 2 activation are potential targets for development of novel therapies to prevent, but not reverse, postoperative pain. PMID: 23249992
  43. Mainly through its serine protease activity, the house dust mite potentiates capsaicin-evoked transiently divalent calcium-ion levels in mouse pulmonary sensory neurons via activation of PAR2. PMID: 22125310
  44. Protease-activated receptor 2 mediates mucus secretion in the airway submucosal gland. PMID: 22916223
  45. Data suggest that the proteinase-activated receptor-2 PAR(2)-enhanced inflammatory process is beta-arrestin-2 dependent, whereas the protective anticonstrictor effect of bronchial epithelial PAR(2) may be beta-arrestin independent. PMID: 23012429
  46. A direct role is found for PAR2 transgene in acute cancer pain in an animal model of head and neck cancer. PMID: 23055487
  47. Deletion of protease-activated receptor 2 prolongs the survival of scrapie in mouse model. PMID: 22694901
  48. These data support an important role for PAR(2) in the pathogenesis of collagen-induced arthritis model PMID: 22563031
  49. analysis of the metastatic potential of B16 melanoma in knock-out (PAR2-/-) animals PMID: 22578959
  50. These results suggest that PAR(2) activation contributes to determination of cells of both osteoblast and osteoclast lineages within bone marrow, and thereby participates in the regulation of skeletal growth and bone repair. PMID: 22173052

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1