Recombinant Mouse Relaxin receptor 1(Rxfp1)

Code CSB-CF764847MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6R6I7
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MTSGPFFFCIFIIGKYFTLGSAQDVSCPLGSFPCGNMSRCLPQLLHCNGVDDCGNRADED HCGDNNGWSLQLDKYFANYYKLASTNSFEAETSECLVGSVPMHCLCRDLELDCDEANLRA VPSVSSNVTVMSLQRNFIRTLPPNGFRKYHELQKLCLQNNRIHSVSVSAFRGLRSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNALTRLPDK PLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINYLNEHAFTHLQKLDEL DLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDCLAKLKSLSLEGIEISNIQQ RMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAITC FGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGVYLFVIGAFDLKFRGEYNKHAQPWM ESVHCQFMGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRTITVLIFIWIIGF IVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGINLVAFIIIVFSYG SMFYSVHQSSVTVTEIQKQVKKEVVLAKRFFFIVFTDALCWIPIFILKFLSLLQVEIPDS ITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWHNYRQRRSVDRKETQKAYAPSFIW VEMWPLQEMSSGFMKPGAFTDPCDLSLVSQSSRLNSYS
Source in vitro E.coli expression system
Gene Names Rxfp1
Protein Names Recommended name: Relaxin receptor 1 Alternative name(s): Leucine-rich repeat-containing G-protein coupled receptor 7 Relaxin family peptide receptor 1
Expression Region 1-758
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:381489

STRING: 10090.ENSMUSP00000077611

UniGene: Mm.331086

Related Products

Rxfp1 Proteins

Rxfp1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.