Recombinant Mouse Spastin (Spast)

Code CSB-CF022488MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Spast
Uniprot No.
Alternative Names
Spast; Kiaa1083; Spg4; Spastin
Species
Mus musculus (Mouse)
Expression Region
1-614
Target Protein Sequence
MSSPAGRRKKKGSGGASPAPARPPPPAAVPAPAAGPAPAAGSPPKRNPSSFSSPLVVGFA LLRLLACHLGLLFAWLCQRFSRALMAAKRSSGTAPAPASPSPPEPGPGGEAESVRVFHKQ AFEYISIALRIDEEEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQYERARRLQAKMM TNLVMAKDRLQLLEKLQPVLQFSKSQTDVYNESTNLTCRNGHLQSESGAVPKRKDPLTHA SNSLPRSKTVLKSGSAGLSGHHRAPSCSGLSMVSGARPGPGPAATTHKGTPKPNRTNKPS TPTTAVRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQELAKQALQEIVILPS LRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKL VRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLV MGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTD GYSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLE AYIRWNKDFGDTTV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ATP-dependent microtubule severing protein that specifically recognizes and cuts microtubules that are polyglutamylated. Preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold. Severing activity is not dependent on tubulin acetylation or detyrosination. Microtubule severing promotes reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. It is critical for the biogenesis and maintenance of complex microtubule arrays in axons, spindles and cilia. SPAST is involved in abscission step of cytokinesis and nuclear envelope reassembly during anaphase in cooperation with the ESCRT-III complex. Recruited at the midbody, probably by IST1, and participates in membrane fission during abscission together with the ESCRT-III complex. Recruited to the nuclear membrane by IST1 and mediates microtubule severing, promoting nuclear envelope sealing and mitotic spindle disassembly during late anaphase. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and endosome recycling. Recruited by IST1 to endosomes and regulates early endosomal tubulation and recycling by mediating microtubule severing. Probably plays a role in axon growth and the formation of axonal branches.; Involved in lipid metabolism by regulating the size and distribution of lipid droplets.
Gene References into Functions
  1. Axon branch loss at the developing mouse neuromuscular junction is mediated by branch-specific microtubule severing, mediated by the microtubule-severing enzyme spastin. PMID: 27773584
  2. Spastin is recruited by microtubules polyglutamylation, induced by Tau missorting triggered translocalization of TTLL6 (Tubulin-Tyrosine-Ligase-Like-6) into dendrites PMID: 24065130
  3. early and marked impairment of microtubule dynamics all along the axons of spastin-deficient cortical neurons, which is likely to be responsible for the occurrence of axonal swellings and cargo stalling PMID: 22773755
  4. we aimed to identify the critical promoter regions of SPG4 gene and effects of Elk1 on SPG4 gene expression PMID: 21395583
  5. Sequence analysis of the SPG4 (spastin) gene identified a novel 1593 C > T (GLN490Stop) mutation in hereditary spastic paraplegia with cerebellar ataxia. PMID: 15667412
  6. two modes by which microtubule severing occurs during axonal branch formation, based on the concentration of spastin at branch sites and on local detachment from microtubules of molecules such as tau that regulate the severing properties of P60-katanin PMID: 18234839
  7. These results strongly support a direct role for defective axonal transport in the pathogenesis of HSP because of spastin mutation. PMID: 19453301

Show More

Hide All

Subcellular Location
Membrane; Peripheral membrane protein. Endoplasmic reticulum. Midbody. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Nucleus. Cytoplasm, cytoskeleton, spindle. Cytoplasm.; [Isoform 1]: Endoplasmic reticulum membrane; Peripheral membrane protein. Nucleus membrane. Lipid droplet. Cytoplasm, cytoskeleton. Endosome.; [Isoform 2]: Cytoplasm. Endosome. Nucleus membrane.
Protein Families
AAA ATPase family, Spastin subfamily
Tissue Specificity
Expressed in brain, heart, liver, lung, skeletal muscle, spinal cord, spleen and testis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1