Recombinant Mouse Sterol regulatory element-binding protein 1 (Srebf1)

Code CSB-CF896228MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Srebf1; Srebp1; Sterol regulatory element-binding protein 1; SREBP-1; Sterol regulatory element-binding transcription factor 1
Species
Mus musculus (Mouse)
Expression Region
1-480
Target Protein Sequence
MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTG PSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPSAPAALKMYPSVSPFSPGPGI KEEPVPLTILQPAAPQPSPGTLLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQP PSSLPLAPAPGVLPTPALHTQVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKA DSLLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH RLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKA IDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTP PPSDAGSPSQSSPLSFGSRASSSGGSDSEPDSPAFEDSQVKAQRLPSHSRGMLDRSRLAL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 1), which is embedded in the endoplasmic reticulum membrane. Low sterol concentrations promote processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes involved in cholesterol biosynthesis and lipid homeostasis.; Key transcription factor that regulates expression of genes involved in cholesterol biosynthesis and lipid homeostasis. Binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC-3'). Regulates the promoters of genes involved in cholesterol biosynthesis and the LDL receptor (LDLR) pathway of sterol regulation.; Isoform expressed only in select tissues, which has higher transcriptional activity compared to SREBP-1C. Able to stimulate both lipogenic and cholesterogenic gene expression. Has a role in the nutritional regulation of fatty acids and triglycerides in lipogenic organs such as the liver. Required for innate immune response in macrophages by regulating lipid metabolism.; Predominant isoform expressed in most tissues, which has weaker transcriptional activity compared to isoform SREBP-1A. Primarily controls expression of lipogenic gene. Strongly activates global lipid synthesis in rapidly growing cells.
Gene References into Functions
  1. Adenosine 2A receptor (AZAR) can directly suppress hepatocyte fat deposition, which is attributable to the effects of A2AR on repressing SREBP1c expression under fasted states and on suppressing SREBP1c transcription activity. PMID: 29315766
  2. our findings suggest that Cidea is highly associated with alcoholic fatty liver disease and Cidea expression is specifically induced by acetaldehyde, and this up-regulation is most likely mediated by SREBP1c. PMID: 29352167
  3. disruption of SREBP-1a phosphorylation resulted in massive alteration of cellular processes, including signs for loss of targeting lipid pathways. PMID: 29587401
  4. Depletion of SREBP-1 had no impact on liver IRS1Y612, AktS473, and downstream effectors GSK3alphaS21 and FoxO1S256 during the fed state. Reduced levels of these molecules were observed under fasting conditions. The contribution of SREBP-1 to maintain insulin signal transduction in liver is modest. PMID: 29723221
  5. Data (including data from studies in transgenic/knockout mice) suggest that Kdm1a-mediated attenuation of Srebf1 transcriptional activities functions as underlying mechanism for suppression of de novo lipogenesis by oxidative stress in white adipose tissue. [Kdm1a = lysine (K)-specific demethylase-1A; Srebf1 = sterol-regulatory element-binding transcription factor-1] PMID: 29618580
  6. Tlr4-mutant mice are resistant to acute alcohol-induced hepatic SREBP-1 activation and hepatic lipid accumulation. PMID: 27627966
  7. LncARSR promotes hepatic lipogenesis via Akt/SREBP-1c pathway and contributes to the pathogenesis of nonalcoholic steatohepatitis. PMID: 29555473
  8. Results showed that Glrx(-/-) mice exhibited decreased SirT1 activity that leads to hyperacetylation and activation of SREBP-1 and upregulation of key hepatic enzymes involved in lipid synthesis. PMID: 27958883
  9. Inhibition of NAMPT aggravates high fat diet-induced hepatic steatosis in mice through regulating Sirt1/AMPKalpha/SREBP1 signaling pathway. PMID: 28449683
  10. SREBP1 is dramatically reduced in dysbindin-1 knockout mice; possibly related to cognitive deficits. PMID: 26873854
  11. Epidermal growth factor receptor (EGFR) signaling enhances miR-29 expression in glioblastoma cells via upregulation of Sterol regulatory element binding protein 1 PMID: 27477273
  12. The expression of hHL promoted hepatic triglyceride accumulation and de novo lipogenesis without affecting triglyceride secretion, and this was associated with an upregulation of Srebf1 as well as the main genes controlling the synthesis of fatty acids. Transgenic mice also exhibited more adiposity and an increased LPL-mediated FFA influx into the WAT without affecting glucose tolerance PMID: 29244870
  13. Data show that miR-200b and miR-200c could directly bind the 3' UTR of JUN, and JUN activated the transcription of srebp1 to increase lipid accumulation. PMID: 27166182
  14. a novel role for SREBP-1 as a cell surface retention factor for TbetaRI in mesangial cells, is reported. PMID: 27826032
  15. Srebp1c is a key regulator of metabolic remodeling leading to the beneficial effects of caloric restriction. PMID: 28256090
  16. The present study indicates a requirement for C/EBPbeta in the insulin-mediated induction of SREBP-1c mRNA expression in rodent liver. Coupled with previous data showing that this induction requires LXRalpha, our data reported herein indicate a requirement for both transcription factors. PMID: 27382175
  17. The deletion of Srebf-2 and subsequent lower sterol synthesis in hepatocytes eliminated the production of an endogenous sterol ligand required for LXR activity and SREBP-1c expression. PMID: 28244871
  18. The fasting-induced transcription factor KLF15, a key regulator of gluconeogenesis, forms a complex with LXR/RXR, specifically on the Srebf1 promoter. PMID: 27545894
  19. Exposure to a xenobiotic during early development induced persistent fat accumulation via hypomethylation of lipogenic genes. Moreover, increased Nrf2 recruitment to the Srebp-1c promoter in livers of BPA-exposed mice was observed. PMID: 28796629
  20. suggesting a specific effect of sterol regulatory element binding protein-1c on neurosteroidogenesis PMID: 28467654
  21. Transforming growth factor-beta activated kinase 1 (TAK1) regulation of sterol-regulatory element-binding proteins (SREBPs) critically contributes to the maintenance of liver homeostasis to prevent steatosis, which is a potentially important mechanism to prevent hepatocellular carcinoma (HCC) development. PMID: 26973245
  22. miR-185 negatively regulates the differentiation of 3T3-L1 cells by targeting SREBP-1 PMID: 28701079
  23. SREBP1 pathway plays an important role in hepatocellular carcinoma pathogenesis. PMID: 28027595
  24. In hepatocytes, E4BP4 interacts with nuclear SREBP-1c to preserve its acetylation, and subsequently protects it from ubiquitination-dependent degradation PMID: 27252523
  25. SREBP1 also contributes to the resolution phase of TLR4-induced gene activation by reprogramming macrophage lipid metabolism. PMID: 28041958
  26. 27OH is not an important regulator of Srebp- or LXR regulated genes under basal conditions in mouse liver PMID: 26851362
  27. Collectively, these findings demonstrate that LXRalpha activation induces 17beta-HSD13 expression in a SREBP-1c-dependent manner. PMID: 28270440
  28. These results demonstrate that HDAC3 and SCAP control symbiotic pathways of liver lipid metabolism that are critical for suppression of lipotoxicity. PMID: 27866836
  29. data indicate that ATF4 regulates SREBP1c expression to control fatty acids synthesis PMID: 27452504
  30. luteolin can abolish lipid accumulation induced by LXR-SREBP-1c activation both in vivo and in vitro PMID: 27888103
  31. results identify PLIN2 as a determinant of global changes in the hepatic lipidome and suggest the hypothesis that these actions contribute to SREBP-regulated de novo lipogenesis involved in non-alcoholic fatty liver disease. PMID: 27679530
  32. the synergistic action of ChREBP and SREBP-1c is necessary for the maximal induction of Elovl6 expression in the liver. PMID: 27524233
  33. observations suggest that MALAT1 promotes hepatic steatosis and insulin resistance by increasing nuclear SREBP-1c protein stability. PMID: 26935028
  34. Advanced glycation end products overproduction in mice liver and skeletal muscle is associated to increased lipogenesis due to the activation of SREBP-1c. PMID: 26721591
  35. Srebp-1 interacts with c-Myc, facilitates its binding to downstream pluripotent targets. PMID: 26388522
  36. SREBP1a or -1c could be acting as transcriptional repressors for rarg2 and when srebf1a expression is down-regulated, its repressing activity disappears. PMID: 26271478
  37. SREBP-2 is critical for survival and limb patterning during development PMID: 26685326
  38. The two cereal dietary fibers potently decreased protein expressions of sterol regulatory element binding protein-1 and key factors involved in lipogenesis PMID: 26510459
  39. regulatory mechanism by which insulin inhibits cardiac UCP3 expression through activation of the lipogenic factor SREBP-1. PMID: 26555260
  40. Mice lacking sterol regulatory element-binding factor-1c (Srebf1c) have blunted peripheral nerve fatty acid synthesis that results in development of peripheral neuropathy. PMID: 25817536
  41. Taken together, our results suggest that an NCE-box within the clusterin promoter is necessary for insulin-stimulated hepatic expression of clusterin via SREBP-1c. PMID: 26282207
  42. both Smad3 and SREBP-1a activation cooperatively regulate TGFbeta transcriptional responses. PMID: 25348957
  43. Endoplasmic reticulum stress and SREBP-1-dependent effects were induced in glomeruli of angiotensin II-infused mice. PMID: 25398788
  44. Data show that knock-in (KI) mice in which a human miR-33b is inserted within sterol regulatory element-binding protein 1 (Srebf1) intron had reduced HDL cholesterol (HDL-C). PMID: 24931346
  45. CREB regulated transcription coactivator 2 (CRTC2) functions as a mediator of mTOR signalling to modulate COPII-dependent SREBP1 processing PMID: 26147081
  46. Thyrotropin increases hepatic triglyceride content through upregulation of SREBP-1c activity. PMID: 25016220
  47. Hepatic genes expression profiles demonstrated that LBP can activate the phosphorylation of AMPK, suppress nuclear expression of SREBP-1c, and decrease protein and mRNA expression of lipogenic genes in vivo or in vitro PMID: 25013763
  48. Fucoidan from Acaudina molpadioides suppressed the mRNA expressions of SREBP-1c, C/EBPa and PPARg in mice. PMID: 24847504
  49. Data show that liver X receptor (LXR) agonist TO901317 increases hepatic fatty acid desaturation via induction of stearoyl CoA desaturase-1 (SCD1) expression in an LXRalpha-dependent and sterol regulatory element-binding protein 1c (SREBP1c)-mediated manner. PMID: 23945440
  50. studies indicate that DEC1 is an important regulator of Srebp-1c expression and links circadian rhythm to hepatic lipogenesis. Activation of Dec1 can alleviate the nonalcoholic fatty liver phenotype PMID: 24993831

Show More

Hide All

Subcellular Location
[Sterol regulatory element-binding protein 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 1]: Nucleus.
Protein Families
SREBP family
Tissue Specificity
[Isoform SREBP-1C]: Predominant isoform expressed in most tissues. Predominates in liver, adrenal gland, brain and adipose tissue. Also found in kidney, thymus, testis, muscle, jejunum, and ileum.; [Isoform SREBP-1A]: Expressed only in select tissues, suc
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1